# PaCkAgE DaTaStReAm EDVlibepsilon 1 1219 # end of header 0707010000e39e000081a40000000000000000000000014551e946000000d2000000760000000700000000000000000000001600000000EDVlibepsilon/pkginfoPKG=EDVlibepsilon NAME=libepsilon ARCH=sparc VERSION=0.3.0.007 CATEGORY=application VENDOR=Enlightenment Developer Team EMAIL=kaethorn@stud.uni-stuttgart.de PSTAMP=Falko Schmidt BASEDIR=/usr/local CLASSES=none 0707010000e39d000081a40000000000000000000000014551e9460000050c000000760000000700000000000000000000001500000000EDVlibepsilon/pkgmap: 1 1219 1 d none bin 0755 bin bin 1 f none bin/epsilon 0755 bin bin 22544 40126 1162995978 1 f none bin/epsilon-config 0755 bin bin 2107 36030 1162995982 1 f none bin/epsilon_thumb_test 0755 bin bin 22856 12609 1162995980 1 f none bin/epsilon_thumbd 0755 bin bin 43280 19470 1162995979 1 i copyright 1632 9450 1115910500 1 i depend 0 0 1162995985 1 d none include 0755 bin bin 1 f none include/Epsilon.h 0644 bin bin 2334 61566 1162995977 1 f none include/Epsilon_Request.h 0644 bin bin 1360 42766 1162995980 1 d none lib 0755 bin bin 1 d none lib/epsilon 0755 bin bin 1 d none lib/epsilon/plugins 0755 bin bin 1 f none lib/epsilon/plugins/xine_thumbnailer.a 0644 bin bin 18684 32656 1162995981 1 f none lib/epsilon/plugins/xine_thumbnailer.la 0755 bin bin 1164 36687 1162995981 1 f none lib/epsilon/plugins/xine_thumbnailer.so 0755 bin bin 20704 57608 1162995981 1 f none lib/libepsilon.a 0644 bin bin 252976 4517 1162995977 1 f none lib/libepsilon.la 0755 bin bin 2115 56606 1162995977 1 s none lib/libepsilon.so=libepsilon.so.0.0.1 1 s none lib/libepsilon.so.0=libepsilon.so.0.0.1 1 f none lib/libepsilon.so.0.0.1 0755 bin bin 191292 49967 1162995976 1 d none lib/pkgconfig 0755 bin bin 1 f none lib/pkgconfig/epsilon.pc 0644 bin bin 300 27798 1162995982 1 i pkginfo 210 17943 1162996038 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010000e39e000081a40000000000000000000000014551e946000000d2000000760000000700000000000000000000000800000000pkginfoPKG=EDVlibepsilon NAME=libepsilon ARCH=sparc VERSION=0.3.0.007 CATEGORY=application VENDOR=Enlightenment Developer Team EMAIL=kaethorn@stud.uni-stuttgart.de PSTAMP=Falko Schmidt BASEDIR=/usr/local CLASSES=none 0707010000e39d000081a40000000000000000000000014551e9460000050c000000760000000700000000000000000000000700000000pkgmap: 1 1219 1 d none bin 0755 bin bin 1 f none bin/epsilon 0755 bin bin 22544 40126 1162995978 1 f none bin/epsilon-config 0755 bin bin 2107 36030 1162995982 1 f none bin/epsilon_thumb_test 0755 bin bin 22856 12609 1162995980 1 f none bin/epsilon_thumbd 0755 bin bin 43280 19470 1162995979 1 i copyright 1632 9450 1115910500 1 i depend 0 0 1162995985 1 d none include 0755 bin bin 1 f none include/Epsilon.h 0644 bin bin 2334 61566 1162995977 1 f none include/Epsilon_Request.h 0644 bin bin 1360 42766 1162995980 1 d none lib 0755 bin bin 1 d none lib/epsilon 0755 bin bin 1 d none lib/epsilon/plugins 0755 bin bin 1 f none lib/epsilon/plugins/xine_thumbnailer.a 0644 bin bin 18684 32656 1162995981 1 f none lib/epsilon/plugins/xine_thumbnailer.la 0755 bin bin 1164 36687 1162995981 1 f none lib/epsilon/plugins/xine_thumbnailer.so 0755 bin bin 20704 57608 1162995981 1 f none lib/libepsilon.a 0644 bin bin 252976 4517 1162995977 1 f none lib/libepsilon.la 0755 bin bin 2115 56606 1162995977 1 s none lib/libepsilon.so=libepsilon.so.0.0.1 1 s none lib/libepsilon.so.0=libepsilon.so.0.0.1 1 f none lib/libepsilon.so.0.0.1 0755 bin bin 191292 49967 1162995976 1 d none lib/pkgconfig 0755 bin bin 1 f none lib/pkgconfig/epsilon.pc 0644 bin bin 300 27798 1162995982 1 i pkginfo 210 17943 1162996038 0707010000e3b3000041ed0000000000000000000000024551e94600000000000000760000000700000000000000000000000800000000install0707010000e3b4000081a40000000000000000000000014283716400000660000000760000000700000000000000000000001200000000install/copyrightCopyright (C) 2005 by various authors Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies of the Software and its Copyright notices. In addition publicly documented acknowledgment must be given that this software has been used if no source code of this software is made available publicly. This includes acknowledgments in either Copyright notices, Manuals, Publicity and Marketing documents or any documentation provided with any product containing this software. This License does not apply to any software that links to the libraries provided by this software (statically or dynamically), but only to the software provided. Please see the COPYING.PLAIN for a plain-english explanation of this notice and it's intent. THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. 0707010000e3b5000081a40000000000000000000000014551e91100000000000000760000000700000000000000000000000f00000000install/depend0707010000e39f000041ed0000000000000000000000054551e94600000000000000760000000700000000000000000000000600000000reloc0707010000e3a0000041ed0000000000000000000000024551e94600000000000000760000000700000000000000000000000a00000000reloc/bin0707010000e3a1000081ed0000000200000002000000014551e90a00005810000000760000000700000000000000000000001200000000reloc/bin/epsilonELF @4R4 (#"44((((l/usr/lib/ld.so.1/.  "#$%')*,- !&(+" @t ) ? FO@ X ^uThP@( | P,G!8d ( t'6,=\S k < pw   D( P@!epsilon_key_setepsilon_generate_start__register_frame_infofwrite_environ__muldi3_finiepsilon_resolution_setepsilon_init_PROCEDURE_LINKAGE_TABLE_strrchr_exitepsilon_info_exif_props_print__iobfprintf__clz_tabepsilon_freeepsilon_thumb_file_get__udivdi3_etextepsilon_info_freeepsilon_exists_edataepsilon_info_exif_get__deregister_frame_infomainatexit_lib_versionepsilon_new_Jv_RegisterClasses_DYNAMICstrcmp_end__dso_handle.umul__divdi3epsilon_info_get_GLOBAL_OFFSET_TABLE_.udivlibc.so.1SYSVABI_1.3libepsilon.so.0libepeg.so.0libImlib2.so.1libedje.so.0libecore_evas.so.1libecore_x.so.1libecore_job.so.1libecore_txt.so.1libecore_config.so.1libecore_ipc.so.1libecore_desktop.so.1libecore_file.so.1libecore_dbus.so.1libecore_con.so.1libecore.so.1libcurl.so.3libidn.so.11libssl.so.0.9.8libcrypto.so.0.9.8libdl.so.1libsocket.so.1libnsl.so.1libevas.so.1libfontconfig.so.1libfreetype.so.6libexpat.so.0libXext.so.0libXrender.so.1libX11.so.4libXp.so.1libXrandr.so.2libiconv.so.2libeet.so.0libz.solibjpeg.so.62libembryo.so.0libm.so.2/usr/local/lib:/opt/csw/lib:/usr/sfw/lib7̳ P"LDP( " ! $ ,8D*P\ht '- @D# @CE#@C@, @ "@Z@C@C㿐#/C``  @  `@@`" `@$@```$``@C`  +㿐㿐/Cͮᨂ` ` @C ```( `@Cw㿐㿐@Cq?. @Co@  .@Cm@E @ClcЀ aE@Cj %Ec@@Cep@Cf "ZFF (p  @C_@C`?١. 0^@C]%F`0@CKpF  p@CK P@CR "GF`?F `27FF @CF F @CB F @C> F  p@C, @C9 " FF! p @C! @C1@C20p  @C!0@C+cؐ# @C*"X0 p  @C F@C   pp   㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ @B@B㿐/B  & #C   € $D` €  $$` $:  `   ?cW?c@` `` 2@  @  @K#@@@ `?@  ؖ 2 @B  @ $@D@`@  $@$@@` $@:  € $D` €  $$` $: `8`y?8 2 6 ,4  *@ @ € #@ C@ `@ €  #@ #@ @ ` #@ : *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 `? @ @"G D   㿐/AL >   $D`  $$` $;    ?cP?c@` `` 2@  @  @D#@@@ `?@    @A  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; [   2 6 *@,4   @ #@ C@ `@  #@ #@ @ ` #@ ;  *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 ?`? @ @ ?   㿐/@`@?㿐㿠7㿠edjdesktop/backgroundThumbnail for %s needs to be generated: OK FAILED Thumbnail already exists %s Thumbnail already exists Meta Info Not Found! URI: %s MimeType: %s Source Image Width: %d Source Image Height: %d Source Image Mtime: %d Trying EXIF Info: Not Found! Found! 40($(00<0H0T0`0l0x00000000000000 0,080D0P0(5DQdt (5EXcr~"0?  IID rd o> o o,  h ooTzR|P  - zR|P d - dD     @    ( T$(0 !"NT"0+6 EU  p t P h |k  40($E <   |-$9 G\l} @t   @  Th#P@)1(  *P;,!H8_d i( pt,\  <   !' 0DA( $P@!W.libs/epsiloncrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__epsilon_main.clibgcc2.c__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START_epsilon_key_setepsilon_generate_start__register_frame_infofwrite_environ__muldi3_finiepsilon_resolution_setepsilon_init_PROCEDURE_LINKAGE_TABLE_strrchr_exitepsilon_info_exif_props_print__iobfprintf__clz_tabepsilon_freeepsilon_thumb_file_get__udivdi3_etextepsilon_info_freeepsilon_exists_edataepsilon_info_exif_get__deregister_frame_infomainatexit_lib_versionepsilon_new_Jv_RegisterClasses_DYNAMICstrcmp_end__dso_handle.umul__divdi3epsilon_info_get_GLOBAL_OFFSET_TABLE_.udivas: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 @(#)SunOS 5.10 Generic January 2005as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482% $ > $ > : ; I : ;  : ; I8  : ; I 8  I : ; .? : ; ' I@ : ; I 4: ; I U4: ; II!I/ 4: ; I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 1 11  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; II!I/ &I4: ;I?  [@ GNU C 3.4.5epsilon_main.c/home/falko/e/e17/libs/epsilon/src/binintlong intlong long int__FILES__FILE_cnt#[#_ptr$S#_base&S#_flag'Y# _file(Y# __orientation)n# __ionolock*n# __seekable+n# __filler,n# Yunsigned char Epsilon_Exif_Info _Epsilon "hash ##src $#thumb %#key &# w '[#h '[#tw ([#th ([#charEpsilon *_Epsilon_Info -uri .#mtime /#w 0[#h 0[#mimetype 1#eei 2#long long unsigned intjEpsilon_Info 4 &main [ @n argc [h argv &i e ,a str   info &2` HH__iob8m@GNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccint long intunsigned charlong long int charshort intshort unsigned intlong long unsigned intlong unsigned intsigned charSItypeIDItypeMfloatdoublelong doubleDWstructChighCH#lowCH#PsNllOV DWunionP k__muldi3V@n uVhi vVjk uuk vvk whi8 __w`aGNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeN floatdoublelong doubleword_typezDWstructChighCW#lowCW#PsNllOt DWunionP [__divdi3,tn u+thi v+tjk c-b uu.hi vv/jk w0t\] ,[@vaPXYh`]Z[] _\]Bx(5[hC\N[[__udivmoddi4UnTdTrpT[nnVaddWarrXd0Yed1Yen0Yen1Yen2Yeq0Zeq1Zeb[ebm[eww$aB__xre__aem1em0eqqH__clz_tab*f;Y4GNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccint'long intunsigned charlong long int'charshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeN floatdoublelong doubleDWstructChighCW#lowCW#PsNllOt DWunionP  __udivdi3g4n nfhi dfjk   % /9aDOZeXpY{h`]\]]_hi[([Z __udivmoddi4UnTdTrpT nnVddWrrXd0Yed1Yen0Yen1Yen2Yeq0Zeq1Zeb[ebm[eww$__xre__aem1em0e  H__clz_tab*9m 44GNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccint4long intunsigned charlong long int4charshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDfloatdoublelong doubleH__clz_tab(y ../../src/lib/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/includeiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hstdarg.hsys/va_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hEpsilon.hepsilon_main.c    Q F N F ( ( 0 8 L L T ` ` h |    8  F N ^  0d ((0@P`x tV# $,@t ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c@D ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h(,,488@~DHLrPTT\`!`shl*j*'8<4<`DXX`d5l~lt4<&HXh7ltx|<f ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h}}r!s dlptt|'4`5~ l@7PTX $("4t ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c4 |  < -  | ,@ -  | X -  | d - _main_q__muldi3%__divdi3 `?__udivdi3__clz_tab <_@ `l,440<H,@(HX (d$unsigned intunsigned intunsigned intunsigned intunsigned int.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab | dd"DDro -B $  7B  AB  , K @ @ TQW]`2((,FTT` en t{d$$((<00d,0F %\](s,,0LAF KNODO P]Q%A% Qf/0707010000e3a2000081ed0000000200000002000000014551e90e0000083b000000760000000700000000000000000000001900000000reloc/bin/epsilon-config#!/bin/sh prefix=/usr/local exec_prefix=${prefix} exec_prefix_set=no usage="\ Usage: epsilon-config [--prefix[=DIR]] [--exec-prefix[=DIR]] [--version] [--libs] [--cflags]" if test $# -eq 0; then echo "${usage}" 1>&2 exit 1 fi while test $# -gt 0; do case "$1" in -*=*) optarg=`echo "$1" | sed 's/[-_a-zA-Z0-9]*=//'` ;; *) optarg= ;; esac case $1 in --prefix=*) prefix=$optarg if test $exec_prefix_set = no ; then exec_prefix=$optarg fi ;; --prefix) echo $prefix ;; --exec-prefix=*) exec_prefix=$optarg exec_prefix_set=yes ;; --exec-prefix) echo $exec_prefix ;; --version) echo 0.3.0.007 ;; --cflags) if test /usr/local/include != /usr/include ; then includes="-I/usr/local/include" fi echo $includes -I/usr/local/include -I$prefix/include ;; --libs) libdirs=-L${exec_prefix}/lib echo $libdirs -lepsilon -L/usr/local/lib -lImlib2 -L/opt/csw/lib -R/opt/csw/lib -lfreetype -lz -L/usr/X11R6/lib -lX11 -lXext -ldl -lm -L/usr/local/lib -lepeg -ljpeg -L/usr/local/lib -ledje -L/usr/local/lib -levas -L/usr/local/lib -leet -lz -ljpeg -L/opt/csw/lib -R/opt/csw/lib -lfreetype -lz -lfontconfig -L/usr/local/lib -lecore -lecore_job -lecore_x -L/usr/X11R6/lib -lX11 -lXext -lecore_evas -lecore_con -lecore_ipc -lecore_txt -liconv -lecore_config -lecore_file -L/opt/csw/lib -lcurl -L/opt/csw/lib -L/opt/csw/lib -lidn -lssl -lcrypto -ldl -lsocket -lnsl -lz -lecore_desktop -lecore_dbus -R/usr/sfw/lib -L/usr/sfw/lib -lssl -lcrypto -lsocket -lnsl -ldl -L/opt/csw/lib -lcurl -L/opt/csw/lib -L/opt/csw/lib -lidn -lssl -lcrypto -ldl -lsocket -lnsl -lz -L/usr/local/lib -leet -lz -ljpeg -L/usr/local/lib -levas -L/usr/local/lib -leet -lz -ljpeg -L/opt/csw/lib -R/opt/csw/lib -lfreetype -lz -lfontconfig -L/usr/X11R6/lib -lX11 -lXext -lXrender -lXp -lXrandr -liconv -lm -L/usr/local/lib -leet -lz -ljpeg -L/usr/local/lib -lembryo -lm -lm @PNG_LIBS@ ;; *) echo "${usage}" 1>&2 exit 1 ;; esac shift done exit 0 0707010000e3a3000081ed0000000200000002000000014551e90c00005948000000760000000700000000000000000000001d00000000reloc/bin/epsilon_thumb_testELF d4S4 (#"4488880/usr/lib/ld.so.1/.  !"#%')*+ $&(,- dt  3d<M VP \`odl8  x4 $4d! 8 pd T<" :<? xh DKch p  (P h 8 `0Hecore_main_loop_quit_start__register_frame_info_environepsilon_shutdown__muldi3_finiEPSILON_EVENT_DONE_PROCEDURE_LINKAGE_TABLE__exitecore_main_loop_beginecore_file_exists__clz_tabecore_file_is_direpsilon_addepsilon_thumb_initsnprintfecore_time_get_etext__udivdi3_edata__deregister_frame_infofreemainatexitecore_event_handler_add_lib_version_Jv_RegisterClasses_DYNAMICecore_file_lsthumb_complete_cb__dso_handle_end.umulputs__divdi3_GLOBAL_OFFSET_TABLE_ecore_file_realpathecore_list_goto_first.udivecore_list_nextlibc.so.1SUNW_1.1libepsilon.so.0libImlib2.so.1libepeg.so.0libedje.so.0libembryo.so.0libecore_evas.so.1libecore_x.so.1libecore_job.so.1libecore_txt.so.1libecore_config.so.1libecore_ipc.so.1libecore_desktop.so.1libecore_file.so.1libecore_dbus.so.1libecore_con.so.1libecore.so.1libcurl.so.3libidn.so.11libssl.so.0.9.8libcrypto.so.0.9.8libdl.so.1libsocket.so.1libnsl.so.1libevas.so.1libeet.so.0libjpeg.so.62libfontconfig.so.1libfreetype.so.6libz.solibexpat.so.0libXext.so.0libXrender.so.1libX11.so.4libXp.so.1libXrandr.so.2libiconv.so.2libm.so.2/usr/local/lib:/opt/csw/lib:/usr/sfw/lib) ='3`\T`d&  !$0+<H-T`*l x' %, @D# @CE#P@C@, @ d"@n@Cv@Cw㿐#/CL`  @  `@@`" `@$@```$``@CS`  +㿐㿐/Cͮ` ` @C= ```( `@C2㿐㿐!!XE$!X#p @C#!X`@C  㻈 $BE@CCa(a`@C  a\@C` "/E@C`@C?@C%F'@C@C$`!@C`@C@C @B    @CX`$X@C#@BȐ?@B#@BĐ @B @B聠?F  @BƐ @B㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ @BȐ@BĒ㿐/Bx  & #C   € $D` €  $$` $:  `   ?cW?c@` `` 2@  @  @K#@@@ `?@  ؖ 2 @Bg  @ $@D@`@  $@$@@` $@:  € $D` €  $$` $: `8`y?8 2 6 ,4  *@ @ € #@ C@ `@ €  #@ #@ @ ` #@ : *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 `? @ @"G D   㿐/Aἒ >   $D`  $$` $;    ?cP?c@` `` 2@  @  @D#@@@ `?@    @A  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; [   2 6 *@,4   @ #@ C@ `@  #@ #@ @ ` #@ ;  *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 ?`? @ @ ?   㿐/@P`@?㿐㿠X㿠# ! EVENT ! THUMB %s -> %s COMPLETE ! STATUS %d ! %d REMAINING ! Usage: epsilon_thumb_test Need a directory%s/%s Epsilon Thumb completed in %g seconds @<84800<0H0T0`0l0x00000000000000 0,080D0P0<L[hu.@N[hx/;FUc) 4 PmmD d oo o, 8 h oodzR|P  - zR|P pd - dD    8 d 4 P h 8 d48< !"|h!-<6Ah P`  {  [  v  @<84\ XP&8 3( N[4g0u dt  d P `d.l@8 J \xu4 }$d!8 pd {T< < xh h h  $ (P 6ChHNS \8 r`0H.libs/epsilon_thumb_testcrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__epsilon_thumb_test.cthumb_doneincomplete_thumbslibgcc2.c__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START_ecore_main_loop_quit_start__register_frame_info_environepsilon_shutdown__muldi3_finiEPSILON_EVENT_DONE_PROCEDURE_LINKAGE_TABLE__exitecore_main_loop_beginecore_file_exists__clz_tabecore_file_is_direpsilon_addepsilon_thumb_initsnprintfecore_time_get_etext__udivdi3_edata__deregister_frame_infofreemainatexitecore_event_handler_add_lib_version_Jv_RegisterClasses_DYNAMICecore_file_lsthumb_complete_cb__dso_handle_end.umulputs__divdi3_GLOBAL_OFFSET_TABLE_ecore_file_realpathecore_list_goto_first.udivecore_list_nextas: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 @(#)SunOS 5.10 Generic January 2005as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482% $ > $ >  I : ; : ; I' I  : ; : ; I8 .? : ; ' I@ : ; I 4: ; I4: ; I  UI!I/4: ; I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 1 11  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; II!I/ &I4: ;I?  H (GNU C 3.4.5epsilon_thumb_test.c/home/falko/e/e17/libs/epsilon/src/binlong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubleEcore_Event_Handler lEcore_Free_Cb.AGS Ecore_List7e _ecore_list7 firstC4# lastD4# currentE4# free_funcG,# nodesI# indexJ#Ecore_List_Node: ._ecore_list_node: data># next?.#SEpsilon_Request"W _Epsilon_Request" id&# size'# status(# path)# dest*# data+# -thumb_complete_cb ( xn datah typei eventjthumb-@ main! xn argc h argv ifile"Qfiles#:`start$wend$realpath:hfullpath;wdoubleaEPSILON_EVENT_DONE.incomplete_thumbs Xthumb_doneE\mGNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccint long intunsigned charlong long int charshort intshort unsigned intlong long unsigned intlong unsigned intsigned charSItypeIDItypeMfloatdoublelong doubleDWstructChighCH#lowCH#PsNllOV DWunionP k__muldi3Vn uVhi vVjk uuk vvk whi __w`aOhGNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeN floatdoublelong doubleword_typezDWstructChighCW#lowCW#PsNllOt DWunionP [__divdi3,thn u+thi v+tjk c-b uu.hi vv/jk w0t\] ,[hva8XYh`]Z[] _\]B`(5[\C\N[[__udivmoddi4UnTdTrpT[nnVaddWarrXd0Yed1Yen0Yen1Yen2Yeq0Zeq1Zeb[ebm[eww$aB__xre__aem1em0eqqH__clz_tab*f; hGNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccint'long intunsigned charlong long int'charshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeN floatdoublelong doubleDWstructChighCW#lowCW#PsNllOt DWunionP  __udivdi3gpn nfhi dfjk  tx % /9axDOZeXpY{h`]\]]_hi[x[Z __udivmoddi4UnTdTrpT nnVddWrrXd0Yed1Yen0Yen1Yen2Yeq0Zeq1Zeb[ebm[eww$__xre__aem1em0e  H__clz_tab*9o pGNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccint4long intunsigned charlong long int4charshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDfloatdoublelong doubleH__clz_tab8y0 ../../src/include../../src/lib/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hEcore_Data.hEcore_File.hEpsilon_Request.hEpsilon.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hresource.hepsilon_thumb_test.c ($ , 8 D H X h x |           $,LX`hxo UTt ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h~r!s dh*ljl*t'4`5 ~  $(&7  $($((PT\<hf ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.hpt}x}r!s 'dh4h`p5~ `h@x7|"t ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c |  (P -  xh -  | H -  | t -  | pd - -Lthumb_complete_cb3mainLq__muldi3%__divdi3 M?__udivdi3__clz_tab (L MhlP0<H,@(HX (d$unsigned intunsigned intunsigned intunsigned intunsigned int.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab | dd"DDo -B $  7B  AB 8 8, K d d Q44WPP]hh288,Fdd` en t{d4488<<<,<PH $(>s+09A OPQ/ QR_A% R/0707010000e3a4000081ed0000000200000002000000014551e90b0000a910000000760000000700000000000000000000001900000000reloc/bin/epsilon_thumbdELF44 (#"44555588/usr/lib/ld.so.1a]  "#$%&')+,-./02578;<=>?@ACDEFGHIKLMNPQRSUVXY[ !(*13469:BJOTWZ\7 6L4 ;#-4d .6X36:6J'h ^7w6$ '@ & t <   'T  ;t81 #898\O8e88p5 wH 7l8 8;77$ 7H( +8h> R6a7r( j0 {77T7 ;$ 5 8Dt $6)756O;U)| ^8d6z1( 87 %p 67 7x707< 8t%8;!,;G:T;p7887-6dHD 8,788}6&  77'8.658P7`waitpidatexit__clz_tab_environ__udivdi3_exitgetpidecore_list_nextepsilon_ipc_consumeecore_con_server_connectecore_con_client_server_getepsilond_cb_client_dataepsilon_ipc_client_sendmainepsilond_cb_worker_dataepsilond_worker_forkepsilon_ipc_server_send_edata_DYNAMIC_finiecore_con_server_sendecore_main_loop_beginecore_con_client_sendecore_init_etextepsilond_cb_worker_addecore_event_handler_delecore_list_destroyecore_list_current_endepsilon_freeepsilon_initepsilond_cb_client_addecore_event_handler_addepsilon_ipc_pushecore_con_shutdown_Jv_RegisterClassesecore_list_newepsilon_generate__muldi3snprintfecore_idle_enterer_addecore_main_loop_quit__register_frame_infoECORE_CON_EVENT_CLIENT_ADDepsilond_cb_worker_del_GLOBAL_OFFSET_TABLE_ecore_con_init_startputsgethostname_PROCEDURE_LINKAGE_TABLE_errno__divdi3.umulecore_list_goto_first_lib_versionreallocmallocepsilond_cb_client_delecore_list_appendperror__deregister_frame_infoecore_con_server_delecore_con_server_addepsilond_initecore_shutdownstrlenECORE_CON_EVENT_CLIENT_DEL__dso_handleECORE_CON_EVENT_CLIENT_DATAecore_list_remove_firstecore_time_getmemmoveepsilon_thumb_sizeepsilond_idle_entererecore_list_removeepsilon_existsstrcpy.udivepsilon_message_newepsilon_newecore_list_nodesmemcpycallocecore_app_args_setlibnsl.so.1SUNWprivate_1.1libc.so.1SUNW_1.1libepsilon.so.0libepeg.so.0libedje.so.0libembryo.so.0libecore_evas.so.1libecore_x.so.1libecore_job.so.1libecore_txt.so.1libecore_config.so.1libecore_ipc.so.1libecore_desktop.so.1libecore_file.so.1libecore_dbus.so.1libecore_con.so.1libecore.so.1libcurl.so.3libidn.so.11libssl.so.0.9.8libcrypto.so.0.9.8libsocket.so.1libevas.so.1libeet.so.0libjpeg.so.62libfontconfig.so.1libexpat.so.0libXrender.so.1libXp.so.1libXrandr.so.2libiconv.so.2libImlib2.so.1libfreetype.so.6libz.solibX11.so.4libXext.so.0libdl.so.1libm.so.2/usr/local/lib:/opt/csw/lib:/usr/sfw/libH NqTd ='n6%6@6-;.;J;H;;66L6X6dO6p@6|-6%6 6Z6>6U66966&63747 <7*7$ 70B7<C7H"7T+7`\7l7xA7 7K7W7N7R77?7,7'7X788L8 8,Q888D18P[8\8h$8tE8F8S888Y8M8;888T @D# @H\L!@HX@, @ "@<@HM@HN㿐#/Hਂ`  @  `@@`" `@$@```(``@H*`  +㿐㿐/Gͮ`$ ` @H ```  `@H 㿐㿐@Hc% ' L`!0 @G   `"$@G$ L`!X  @G @G 㿐@Gc% * ` @Gǐ   `"$@G$ L`!p @G  @GL@G!ߒ 㿐@Gc A#c`9L@G@G ,c @ $ @ %L`&@G @ c`" @Gv `2@G|$ c` L@Gw!0@Gd!0Ɓ 㿐@GUc ;#c`4L@GY@GZ 'c @  @#@l  @G3 " "@G/c@\  0 c`L@G3!0@G0"0́ 㾐!@G+@G,!L ! @G%㿐@G#-@G'@G@G@G c%Lߐ"(㘀`c @G  c@G+Eb@G c c)Iap@G# c1F`@F# cL"0㘀`5  @F  c@FEcH@Fc cI`@F# cF#Ԕ@Fגa<# b  c @F @F$@F b耦 GL@F"@ʖ L@F"@G#H@F 㿐@F@F  & c`2L @Fx"P !@F##$#@Fc!$c@F##$#@Fc!@F#L$#$cC"0  @F m& +c`dL@Fpc`V@F + @F|@F| c` 9%@Fx &`L c`L@Fn$ $ @N  L@Fg"@FV 2ڦ @Fc 0;@F'" @F"0@F[ `"cL@F"cL@F"0L`ʐ"@F c@FCL@E#0@E"p0c`2L@E̐ @E#@0㿈-`L')L+L/L@F (@EҐ@EӐ @ @@ @ @ ``@ؒ @EҐ@EА@E 2`L)@E##L'%L@E# $ `'` @E @ c`$ @E@E @E# 2 @E}05@E{ 0@E#`  @E  @E` @E#/;L9M7M@E#  `h  @E#@EB#@EC#   `~@E:# @Ez#M`p;c @E1#``I'@EjM@E HB)L@E#x@E@`"V``@E c`@( R@EF0N @Dz$ @Dc @EF @ iЀ` Pdc@D#E)@E4 2@E` ` +@DՒc` @D@D͐c@Dǒc` @DÔc`@D00@D#s@E x( s @E !Mc`p H;cȁ*+`"  ?M  @D ` 㿐 ` 0@D@D  @D &  㿐@Doc c`2M@Ds0@Ds@D  @@DА0@DW x0 㿐@DHc c`2M@DL0@DL@D  @@D0@D0 0 㿐@D@D@D@D@D@Dc`@DM@D ؁ 㿐`  @Dy @Ds @D  b`#b;c["" " " " ` @D] @DW````㿐   `@$@@C @D>`@D;$ @C$$$㿐`   @  @  @ @D @& @D& & @C&  & & 㿐>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @ @C@Cޒ㿐/Cl  & #C   € $D` €  $$` $:  `   ?cW?c@` ``2@  @  @K#@@@ `?@  ؖ 2 @C  @ $@D@`@  $@$@@` $@:  € $D` €  $$` $: `8`y?8 2 6 ,4  *@ @ € #@ C@ `@ €  #@ #@ @ ` #@ : *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 `? @ @"G D   㿐/Bఒ >   $D`  $$` $;    ?cP?c@` ``2@  @  @D#@@@ `?@    @B  @ @ $@D@`@ @  $@$@@`@ $@;`  $D`  $$` $; [   2 6 *@,4   @ #@ C@ `@  #@ #@ @ ` #@ ;  *. :  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@ @8 ?`? @ @ ?   㿐/AD`@?㿐㿠>㿠 !!! client %p connected to server! Added client %d Added worker client %d ?? Worker added to %ld ?? !!! client %p sent data ** Received %s ** ERROR: No matching client for data?? Worker data ??%s-%sepsilonepsilondsocket name %s Created worker thread %ld Connecting to %s Cached thumbnail existsThumbnailing of %s complete writeFailed to thumbnail %s Thumbnailing %s Thumbnail generatedRunning worker thread %p for %d thumbnails Failed connection to %s Idle state entered%ld sending response to %d Client %p Finished responsesCollecting child %ld Collected child %ld status %d Dispatching message %d Assigning %s to worker %p Dispatched message %d Preparing %d responses Idle time %g !!! worker %p disconnected from server! !!! client %p disconnected from server! Process %ld shut down 8;;|;x;p;l:400<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0Nw 4GZlzH)8FUfnzd 0 1  oz&oo  oo6zR|P )| - zR|P -4d - ;   0 1 1( 5 68::;;;l;p;x !";);x2:=1( L\< w W ::;;rx ;|;x;p;l;;;";:;F:P;^$H ;;HL :;;;;%:))))L3;E0 @0 [::h;lt;h76L4 ;-4d 6X66'h 7 6.$ )'@ A& t <  F ['T s;tz81 88\8885 tH 7l8 8; 7-7$ :7HR( c8hv 67( 0 77T7 ;$ 5 /8D>t E6J7V6p;v)| 861( 87 %p 67 7x70(7<  8t/8;!6;Q:^;z78876dHD 8,7886& 7 71886?8PV7`.libs/epsilon_thumbdcrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__epsilon_thumbd.cidle_timedebugqueued_workersepsilond_cb_worker_dataepsilond_cb_client_dataclient_idthumbd_serverepsilond_client_cleanepsilond_cb_worker_addepsilond_cb_client_addepsilond_socket_pathworker_limitthumb_serverepsilond_cb_client_delresponse_queueepsilond_cb_worker_delepsilon_thumb_common.cmidlibgcc2.c__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START_waitpidatexit__clz_tab_environ__udivdi3_exitgetpidecore_list_nextepsilon_ipc_consumeecore_con_server_connectecore_con_client_server_getepsilon_ipc_client_sendmainepsilond_worker_forkepsilon_ipc_server_send_edata_DYNAMIC_finiecore_con_server_sendecore_main_loop_beginecore_con_client_sendecore_init_etextecore_event_handler_delecore_list_destroyecore_list_current_endepsilon_freeepsilon_initecore_event_handler_addepsilon_ipc_pushecore_con_shutdown_Jv_RegisterClassesecore_list_newepsilon_generate__muldi3snprintfecore_idle_enterer_addecore_main_loop_quit__register_frame_infoECORE_CON_EVENT_CLIENT_ADD_GLOBAL_OFFSET_TABLE_ecore_con_init_startputsgethostname_PROCEDURE_LINKAGE_TABLE_errno__divdi3.umulecore_list_goto_first_lib_versionreallocmallocecore_list_appendperror__deregister_frame_infoecore_con_server_delecore_con_server_addepsilond_initecore_shutdownstrlenECORE_CON_EVENT_CLIENT_DEL__dso_handleECORE_CON_EVENT_CLIENT_DATAecore_list_remove_firstecore_time_getmemmoveepsilon_thumb_sizeepsilond_idle_entererecore_list_removeepsilon_existsstrcpy.udivepsilon_message_newepsilon_newecore_list_nodesmemcpycallocecore_app_args_setas: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 @(#)SunOS 5.10 Generic January 2005as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482% $ > $ >  I : ;I: ; &I : ; I ' I  : ; : ; I8  : ; I8 < < : ; I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I4: ; I4: ; I .? : ;' I@ : ;I 4: ;I4: ;I 4: ;I  U .: ;' I@ !: ;I "I#!I/ $.? : ;I@ %4: ;I &1'1(41)41 *.: ;' I +: ;I, - U.1/ 0: ;I14: ; I? < % $ > $ >  I: ; I<  : ;  : ; I8 : ; I  : ; .? : ; ' I@ : ; I 4: ; I4: ; I  .? : ; ' @ % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 4: ;I  U&I% $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 4: ;I 111  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; I : ; : ;I8  : ; : ;I : ;I .? : ;' I@ : ;I 1 11  U4141  U .: ;' I : ;I4: ;I   I&II!4: ;I? < % $ > $ > : ; II!I/ &I4: ;I?   &GNU C 3.4.5epsilon_thumbd.c/home/falko/e/e17/libs/epsilon/src/bin6long intunsigned charcharshort intintlong long intshort unsigned int6long long unsigned intlong unsigned intlong doublepid_tdEcore_Event_Handler ldoublefloatO Ecore_Free_Cb).io {  Ecore_List)7 _ecore_list)7 first)C[# last)D[# current)E[# free_func)GT# nodes)I# index)J# Ecore_List_Node): U_ecore_list_node):o)># next)?U#{ Ecore_Con_Server*C_Ecore_Con_Server Ecore_Con_Client*D_Ecore_Con_Client Ecore_Con_Event_Client_Add*P _Ecore_Con_Event_Client_Add*PC*[# Ecore_Con_Event_Client_Del*Q6 i_Ecore_Con_Event_Client_Del*QC*`# Ecore_Con_Event_Client_Data*T _Ecore_Con_Event_Client_Data *TC*o#o*p# size*q#g Epsilon_Message3 _Epsilon_Message3 head3# nid3# mid3#`3# thumbsize3# bufsize3# cl3#Q3" 3" buffer3%# bufsize3&# offset3'# ]_Epsilon 5" hash5## src5$# thumb5%# key5&# w5'# h5'# tw5(# th5(# Epsilon5*Q6 w _Epsilon_Client6 id6##C6$# thumbs6%a# ipcend6'# Epsilon_Worker6: ?_Epsilon_Worker6: thumbs6=a# child6># server6?# ipcend6@# Epsilon_Response6GW _Epsilon_Response6GC6J# msg6K#lepsilond_cb_client_add6mHno6la 6li6ljcl6n`e6og6paepsilond_cb_worker_add6Hno6h 6i6jcl6`e66aa$epsilond_cb_client_data6<no6h 6i6je6$cl6`g6amsg6jiepsilond_cb_worker_data63<Hno62h 62i62je64$cl65`66amsg6Jj6R? 7epsilond_socket_path6Hn!name6[buf6asockname6 7}" G#]$ epsilond_init6nwi6hbuf6`%g6ab%6aa4J6  Xepsilond_worker_fork6HnJ6 h@buf6`& X' z( ) ` ) d) c) a* epsilond_worker_run6+o6J6 msg6,`6path6ep6 ] epsilond_idle_enterer6H$no6hidle6acl6a%6b%J6 `g6 a- c8msg6+`- P%`6Fl&   ' :  ( F- h%,6d`. S!4!' z) `) b/ #4#) c$$now66*+* Sepsilond_worker_clean6+J6 msg6* epsilond_client_dispatch6e0cl6dJ6f ,6g,msg6u epsilond_client_clean6$$n!cl6h$$msg6 sepsilond_cb_worker_del6$%pno6h 6i6je6 scl6`6a epsilond_cb_client_del6%p& no6h 6i6je6 scl6`g6a+main6& &n!argc6X!argv6+YI1ECORE_CON_EVENT_CLIENT_ADD*1ECORE_CON_EVENT_CLIENT_DEL*1ECORE_CON_EVENT_CLIENT_DATA*1errno7(client_id6N:debug6O;idle_time6P6;worker_limit6R:client_add6T ;client_del6U ;client_data6V ;worker_add6X ;worker_del6Y ;worker_data6Z ;queued_workers6\a;thumb_server6^;thumbd_server6_;response_queue6aa;v(&GNU C 3.4.5../../src/common/epsilon_thumb_common.c/home/falko/e/e17/libs/epsilon/src/binlong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubledoublefloatEcore_Con_Server*CQ_Ecore_Con_ServerEcore_Con_Client*D}_Ecore_Con_Cliente9Epsilon_Message3=_Epsilon_Message3head3#nid3#mid3#status3# thumbsize3#bufsize3#cl3N#Epsilon_Client= t3"_ t 3"buffer3%#bufsize3&#offset3'# Tepsilon_message_new4 T&'@n nid4 b path4 i dst4 j status4 k size4 msg4 Thdstlen4 `pathlen4a&'8 body4 epsilon_ipc_client_send44'@'T^ cl43X msg43TY epsilon_ipc_server_send4;'T'h^ srv4:X msg4:TY jepsilon_ipc_consume4ET'h(n end4Djcremains4Famsg4GTb'(size4K`msg24LThTepsilon_ipc_push4w((n end4vjh data4vi size4vjmid4:m]/)t(GNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intsigned charSItypeIDItypeMfloatdoublelong doubleDWstructChighCH#lowCH#PsNllOV DWunionP k__muldi3V()tn uVhi vVjk uuk vvk whi __w`a+-,)tGNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeN floatdoublelong doubleword_typezDWstructChighCW#lowCW#PsNllOt DWunionP [__divdi3,t)|-,n u+thi v+tjk c-b uu.hi vv/jk w0t\] ,[)*,vaXYh`]Z[] _\]B(5[+- C\N[[__udivmoddi4UnTdTrpT[nnVaddWarrXd0Yed1Yen0Yen1Yen2Yeq0Zeq1Zeb[ebm[eww$aB__xre__aem1em0eqqH__clz_tab*f;0-,GNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDSItypeIUSItypeJDItypeMUDItypeN floatdoublelong doubleDWstructChighCW#lowCW#PsNllOt DWunionP  __udivdi3g-40n nfhi dfjk  -8-< % /9aDOZeXpY{h`]\]]_hi[/<0[Z __udivmoddi4UnTdTrpT nnVddWrrXd0Yed1Yen0Yen1Yen2Yeq0Zeq1Zeb[ebm[eww$__xre__aem1em0e  H__clz_tab*9 00GNU C 3.4.5../../sources/gcc-3.4.5/gcc/libgcc2.c/export/home/pfelecan/CSW/ports/gcc3core-3.4.5-SunOS5.8-sparc-CSW.pkg/objdir/gccintlong intunsigned charlong long intcharshort intshort unsigned intlong long unsigned intlong unsigned intsigned charUQItypeDfloatdoublelong doubleH__clz_tab4y ../../src/include../../src/lib/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hsocket_impl.hun.hnet/if_dl.hnetinet/in.hmachlock.hmutex.hrwlock.hsemaphore.hcondvar.hrwstlock.hcred.huio.hresource.hvm/seg_enum.hkstat.hvmem.hkmem.havl_impl.havl.hvnode.hpoll.hmodel.hstrft.hstream.hnetconfig.hsocket.hnetdb.hEcore_Data.hEcore_Con.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hepsilon_private.hinttypes.hEpsilon.hepsilon_thumbd.cerrno.h6   (0s8H(L\`dp s008HP\(\ldppxx$d<8@TT\lt+i   4aHL\dhlx| |" # (Hht||(4@@HPe`hfx?~8_ $048<H\``h|GZ  ((0DZD:LLLLXi`hxs t l\u(0H'Lp/||n n &  ( @( Tp \ \ d t    ~ p $   ! !!! ! ~! !,!, !4~!@N!@F!HV!d4!xg!)!!!!O!E!!!!! !""" ""("0"<"h """"""," """##n## ~#,)#,k#4#<#@#@#H#T#`#p#x#s####$######$ $ $$$8$8$D$P$$$$$${$$$$%% %0 %D%L%Xs%pS%t%%%%% % %%%s& &&& &$&,&4&<&D&L&`&1e ../../src/common../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hsocket_impl.hun.hnet/if_dl.hnetinet/in.hmachlock.hmutex.hrwlock.hsemaphore.hcondvar.hrwstlock.hcred.huio.hresource.hvm/seg_enum.hkstat.hvmem.hkmem.havl_impl.havl.hvnode.hpoll.hmodel.hstrft.hstream.hnetconfig.hsocket.hnetdb.hEcore_Data.hEcore_Con.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hepsilon_private.hepsilon_thumb_common.c&4&& &&&&&&&&&&&&&&&&&&'''' ''' '$'('('0'@'@'T'T'h'l'p't'x'|"'|u'''' '' '''''''''''' ''' ''''(( (((($(((,(0(4(4(<(L(\ (\(t ((((t ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c(()D)H)L)h)t ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h)|)))))))~)))r)))))!)s))*(*,**0j*0**8*D*H*L*L*T'**4*`*****5*~*****+D++&+++7+++++++,D,H,L,,,--- <-,f ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.clonglong.h-4-8}-<-H}-L-Pr-T-X-X-`-d!-ds-l-p-t------'.(.,4.,`.4.H.H.P.T5.\~.\.d.p.t.x./$/,@/<7/@/D/H/L/P/T/X///0X0\0\000"0t ../../sources/gcc-3.4.5/gccinclude/usr/include/usr/include/sysstddef.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime.hiso/time_iso.htime_impl.htime.hselect.hiso/stdlib_iso.hstdlib.hconfig/sparc/sparc.hlibgcc2.hlibgcc2.c0 |  - H - $ - <  - HL -  -  - HD - $H - $ - %p - & t -  | `& -  `'@ `'T`'h - `( -  | ( -  | )| -  | <-4d - epsilond_cb_client_addepsilond_cb_worker_addepsilond_cb_client_data*epsilond_cb_worker_data Gepsilond_init epsilond_worker_fork epsilond_idle_enterer epsilond_cb_worker_del yepsilond_cb_client_del mainepsilon_message_newZepsilon_ipc_client_sendepsilon_ipc_server_sendepsilon_ipc_consumepepsilon_ipc_pushq__muldi3O%__divdi3?__udivdi3 __clz_tab&$(O)t-,l@DPt$` < D < d l ` 8 , `0<H,@(HX (d$responsetypeworkerseventEpsilon_Ipc_Endavailableunsigned intclientworkerEpsilon_ClientstatusclientsdataEpsilon_Ipc_Endunsigned intunsigned intunsigned intunsigned intunsigned int.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.data.rel.local.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.shstrtab  " o@-B$  7B< AB   K8Q00W11]1(1(255,F66 e88n::t::{;;;;d;l;l;p;p<;x;xl;t @X FRNQ?X!z Xh q0% f/0707010000e3a5000041ed0000000000000000000000024551e94600000000000000760000000700000000000000000000000e00000000reloc/include0707010000e3a6000081a40000000200000002000000014551e9090000091e000000760000000700000000000000000000001800000000reloc/include/Epsilon.h#ifndef EPSILON_H #define EPSILON_H #ifdef EAPI #undef EAPI #endif #ifdef WIN32 # ifdef BUILDING_DLL # define EAPI __declspec(dllexport) # else # define EAPI __declspec(dllimport) # endif #else # ifdef __GNUC__ # if __GNUC__ >= 4 # define EAPI __attribute__ ((visibility("default"))) # else # define EAPI # endif # else # define EAPI # endif #endif #define EPSILON_FAIL 0 #define EPSILON_OK 1 typedef void Epsilon_Exif_Info; #define EPSILON_ED_CAM 0x02 /* Camera-specific info. */ #define EPSILON_ED_IMG 0x04 /* Image-specific info. */ struct _Epsilon { char *hash; char *src; char *thumb; char *key; int w, h; int tw, th; }; typedef struct _Epsilon Epsilon; struct _Epsilon_Info { char *uri; unsigned long long int mtime; int w, h; char *mimetype; Epsilon_Exif_Info *eei; }; typedef struct _Epsilon_Info Epsilon_Info; enum _Epsilon_Thumb_Size { EPSILON_THUMB_NORMAL, EPSILON_THUMB_LARGE }; typedef enum _Epsilon_Thumb_Size Epsilon_Thumb_Size; EAPI void epsilon_init (void); /* construct destruct */ EAPI void epsilon_free (Epsilon * e); EAPI Epsilon *epsilon_new (const char *file); /* Set the part name as key (Edje for now)*/ EAPI void epsilon_key_set (Epsilon * e, const char *key); /* Set the resolution*/ EAPI void epsilon_resolution_set (Epsilon * e, int w, int h); /* * the source filename */ EAPI const char *epsilon_file_get (Epsilon * e); /* * the thumbnail filename */ EAPI const char *epsilon_thumb_file_get (Epsilon * e); /* * returns EPSILON_FAIL if no thumbnail exists, EPSILON_OK if it does */ EAPI int epsilon_exists (Epsilon * e); /* * returns EPSILON_FAIL if no errors, EPSILON_OK if write goes ok */ EAPI int epsilon_generate (Epsilon * e); /* * set output thumb size */ EAPI void epsilon_thumb_size(Epsilon *e, Epsilon_Thumb_Size size); /* * get the meta information associated with the epsilon */ EAPI Epsilon_Info *epsilon_info_get (Epsilon * e); EAPI void epsilon_info_free (Epsilon_Info * ei); EAPI int epsilon_info_exif_props_as_int_get (Epsilon_Info * ei, unsigned short lvl, long prop); EAPI const char *epsilon_info_exif_props_as_string_get (Epsilon_Info * ei, unsigned short lvl, long prop); EAPI void epsilon_info_exif_props_print (Epsilon_Info * ei); EAPI int epsilon_info_exif_get (Epsilon_Info * ei); #endif 0707010000e3a7000081a40000000200000002000000014551e90c00000550000000760000000700000000000000000000002000000000reloc/include/Epsilon_Request.h#ifndef _EPSILON_REQUEST_H #define _EPSILON_REQUEST_H #ifdef EAPI #undef EAPI #endif #ifdef WIN32 # ifdef BUILDING_DLL # define EAPI __declspec(dllexport) # else # define EAPI __declspec(dllimport) # endif #else # ifdef __GNUC__ # if __GNUC__ >= 4 # define EAPI __attribute__ ((visibility("default"))) # else # define EAPI # endif # else # define EAPI # endif #endif /** * @file * @brief Functions for dealing with Epsilon thumbs. */ #ifdef __cplusplus extern "C" { #endif typedef struct _Epsilon_Request Epsilon_Request; /**< A thumb handle */ struct _Epsilon_Request { unsigned int id; /**< Identifier for this thumbnail */ unsigned int size; /**< Thumbnail size to be generated */ unsigned int status; /**< Status code of the thumbnail generation */ char *path; /**< Path to file requiring thumbnail */ char *dest; /**< Path to generated file, NULL on error */ void *data; /**< Data associated with this thumbnail. */ }; EAPI extern int EPSILON_EVENT_DONE; EAPI int epsilon_thumb_init(void); EAPI int epsilon_shutdown(void); EAPI Epsilon_Request *epsilon_add(char *path, char *dst, int size, void *data); EAPI void epsilon_del(Epsilon_Request *thumb); EAPI void epsilon_pause(); EAPI void epsilon_resume(); #ifdef __cplusplus } #endif #endif 0707010000e3a8000041ed0000000000000000000000044551e94600000000000000760000000700000000000000000000000a00000000reloc/lib0707010000e3a9000041ed0000000000000000000000034551e94600000000000000760000000700000000000000000000001200000000reloc/lib/epsilon0707010000e3aa000041ed0000000000000000000000024551e94600000000000000760000000700000000000000000000001a00000000reloc/lib/epsilon/plugins0707010000e3ab000081a40000000200000002000000014551e90d000048fc000000760000000700000000000000000000002d00000000reloc/lib/epsilon/plugins/xine_thumbnailer.a! / 1162995967 0 0 0 144 ` 8888888clipi_yuy2_to_yv12ptiyv12_to_rgbepsilon_plugin_initepsilon_generate_thumbepsilon_thumb_imlib_standardize// 1162995967 0 0 0 40 ` xine_thumbnailer_la-xine_thumbnailer.o/ /0 1162995963 0 0 100644 18312 ` ELFD@4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.debug_frame.debug_pubnames.debug_aranges.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment%  : ;  : ; I8  I$ > : ; I$ >  ' I : ; I8 ' I &I< .? : ; I@ 4: ; I 4: ; I.? : ; ' I@ : ; I .? : ; ' @ .? : ; ' I@  : ;4: ;I  4: ;II!I/.? : ;I@ GNU C 3.4.5xine_thumbnailer.c/home/falko/e/e17/libs/epsilon/src/plugins_Epsilon "hash##src$#thumb%#key&# w'#h'#tw(#th(#charintEpsilon*clong long unsigned intlong intunsigned charshort intlong long intshort unsigned intlong unsigned intlong doubleImlib_Image 'Ecore_Free_Cb.  Ecore_List7k_ecore_list7firstC#lastD#currentE#free_funcG# nodesI#indexJ#Ecore_List_Node:_ecore_list_node:data>#next?#kEpsilon_Plugin_Epsilon_Pluginmime_types #  4# . .@ 3xine_tSYxine_sxine_stream_tTwxine_stream_sxine_audio_port_tUxine_audio_port_sxine_video_port_tVxine_video_port_sdoubleb^_epsilon_xine_param"xine"^#stream"#vo_port"#ao_port"# Kepsilon_xine_param"epsilon_thumb_imlib_standardize")ndst"*hdw"+bdh"+hsw",ash",`s"-%clip"I^val"HXi_yuy2_to_yv12"Snsrc"Qhdest"QEiwidth"Qjheight"Rkstride"Tai"UZj"U\img_y"VEiimg_cb"WE`img_cr"XEX 3qyv12_to_rgb"tnname"s:hw"sih"sbuf"sqrp"sw_y"uEl_u"vEj_v"wEh_rgb"xEd__rgb"yEehw"{khh"{`i"}\j"}by"Qu"Qv"]r"ag"hb"io"Xjo"Xsx"'fsy"'Xymin"Tymax"Pyt"ret"`dst"LEpti"^ti"Xfloat z"ne".fret"`img"wbuf"Ewcnt"`attempts"clength"wpos_perc"wpos_time"wnew_perc"wnew_time"wreq_perc"ereq_time"dold_length"cfg" zwparam" bdone"try_get_chance"Cclose_stream"w"5wh"5wratio"5wformat"5wbuf2"jtmp"ka  d epsilon_plugin_init" nplugin"  3 ../../src/include../../src/lib/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/opt/csw/include/usr/include/usr/include/sys/usr/local/includeEpsilon.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hX11/X.hstddef.hX11/Xlib.hImlib2.hEcore_Data.hepsilon_plugin.hauxv.hdlfcn.hstat.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hinttypes.hxine.hsched.hpthread.hxine/xmlparser.hxine/configfile.hxine/xineutils.hxine_thumbnailer.c"< ' q q$p.o$ 3a3a3_3_ ut u rui*j.CV t  ~  [  -g  u&nOEOCQ FAsS㿐@ @* @@  @ @ @@ @ 0@,`   `4 㿐@>>@ 2 6* .@ `.@ ` .@ @ 8`, `.@ @ 8`*  `  Ԙ h'L@L 2: `' 0`2 8` 'P: 'T':' ''' '@L'̀ ?@@ @ @ 'Lq'ܕ.`'Ⱥ  @ؖL''ت@  [@@L  @ @@ @@'`` R' H``?'𡢉R𕢉H` RΙLJH'𝣈N'L,'  'Ԁ &'@-@@, @?, , L@ؐ? P@?@P#@T`#@@  #dd ` `#`?' ''@ @ $ !!D @ $@@@!  @ $@' ' `)`+@Ē  @$ @ $@ u?Ā`"@'@ `$@`$ @$ Ԁ`Š?@@ 'ȚؔԖ@̀ ؀ Ԁ` ÛaY@ UbY@Ԗ@Ā?Ā`"?@?'Ȁ "?@, @(`@(`?@c@ 'Ȫ#,@(` @(`@(`䀥 4+?'' @ "^'ܠ #쀤 1 @ #`@ `@ 1 䀣`H  1ܖ @  #쀣@܀@ @ 1ܖ  `ؔԖИ@ 2Wئ c$#耥@?'' @ c''@  ?Ȁ @?0@@Ȑ@'@ UbY@'@'??㿐 @ `@" `@&`@`@`@argb?ae?7KƧ?@N?tj@#9@L%s%s.xine/confignonevideo/mpegvideo/x-ms-wmvvideo/x-msvideovideo/quicktime |  -  $ -   - <xX - p -  ~epsilon_thumb_imlib_standardizeclip%i_yuy2_to_yv12yv12_to_rgb}ptiepsilon_generate_thumb epsilon_plugin_init unsigned intepsilon_generate_thumb   !$&-H_n< (@W`j|  lp38GQXhrxine_thumbnailer.cold_length.0clipcallocimlib_context_set_cliprectimlib_image_get_heighti_yuy2_to_yv12xine_get_homedirimlib_create_imageimlib_create_cropped_scaled_imagexine_open_video_driverimlib_free_imagepti.divimlib_context_set_imagexine_disposeusleepxine_open_audio_driverxine_close_video_driverimlib_image_set_formatxine_newxine_initecore_list_appendyv12_to_rgbxine_get_current_framexine_stream_newepsilon_plugin_initimlib_image_put_back_dataxine_closexine_config_loadmallocimlib_context_set_anti_aliasimlib_image_get_widthfreeecore_list_newxine_openepsilon_generate_thumbxine_playxine_close_audio_driverxine_get_pos_lengthimlib_image_set_has_alpha.umulepsilon_thumb_imlib_standardizesnprintfimlib_image_get_data  !y  =A  l   U Y D  l    (4Hpx "*2:BJRZbjrz $(,48<@@HLLT\ ptx"|*2<DLT^fpx  $ ((,20:4B<J@RDZLbLjTrXzllt|"* 2<:HBTJXR`Zhb|jr|  (2:BL$T(\0d0l8tD|PX`ddlt"*2:BJRZb j$r(z,4<@HLTT\   $ < 'H /H 7P ?X GX O` Wh _p gx o w                 $ 8 D D %L -` 5d =d El Mt Ut _| g o w             $ 8 8 @ l l   " * 2 : B J R Z b j t  |   (  4  T  T  \  `  d  d  l  t  t  |        $ , 4 < D L T \ d l t |      (  ,  4  D  L  T  \  l  p  |         ( 0 + (@\px*3444\t|  37,4@l t | ( (      8 D P x,& 8 8 0 0,4\l @p Ht @x H6(  X X5, X($<.`p14)#X",,0D `2x 2  , 0 H# 0 0 ' 4 )  ,, D, t |/ / - ` ` ! p p ! ! !04@D\`x| las: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 1 % 71 7$?%@E%DR&b& q&$|& *l-hP  .x  >0  C4  C  C  D?0707010000e3ac000081ed0000000200000002000000014551e90d0000048c000000760000000700000000000000000000002e00000000reloc/lib/epsilon/plugins/xine_thumbnailer.la# xine_thumbnailer.la - a libtool library file # Generated by ltmain.sh - GNU libtool 1.5.22 (1.1220.2.365 2005/12/18 22:14:06) # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='xine_thumbnailer.so' # Names of this library. library_names='xine_thumbnailer.so xine_thumbnailer.so xine_thumbnailer.so' # The name of the static archive. old_library='xine_thumbnailer.a' # Libraries that this one depends upon. dependency_libs=' -R/opt/csw/lib -L/opt/csw/lib/sparcv8plus /opt/csw/lib/sparcv8plus/libxine.la -L/opt/csw/lib /opt/csw/lib/libintl.la -lc -lposix4 -lnsl -lsocket -lpthread /opt/csw/lib/libiconv.la -lrt -L/usr/local/lib /usr/local/lib/libImlib2.la -L/usr/X11R6/lib /opt/csw/lib/libfreetype.la -lz -lX11 -lXext -ldl -lm' # Version information for xine_thumbnailer. current=0 age=0 revision=0 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=yes # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/local/lib/epsilon/plugins/' 0707010000e3ad000081ed0000000200000002000000014551e90d000050e0000000760000000700000000000000000000002e00000000reloc/lib/epsilon/plugins/xine_thumbnailer.soELF4K4 (! $$$8;9  $%&'(+,-./027 !"#)*134568 ` 0GP du  X " l$ 2Md dk|  "* 9NfL    $ #(2EYbz__dso_handle_endimlib_context_set_anti_aliasimlib_image_set_formatsnprintfepsilon_plugin_initxine_get_homedirxine_close_edataptixine_get_current_framexine_dispose__register_frame_infoepsilon_thumb_imlib_standardizeecore_list_newxine_init_DYNAMICxine_config_load_PROCEDURE_LINKAGE_TABLE_imlib_context_set_cliprectepsilon_generate_thumbusleepimlib_free_image_finimallocxine_open_audio_driverimlib_create_cropped_scaled_imageimlib_image_put_back_data_lib_versionxine_open_video_driver__deregister_frame_infoecore_list_appendi_yuy2_to_yv12imlib_image_get_dataimlib_context_set_imageimlib_image_set_has_alphayv12_to_rgb_etextcalloc_Jv_RegisterClassesxine_close_audio_driverimlib_image_get_width_GLOBAL_OFFSET_TABLE_xine_play.divclipimlib_image_get_height.umulfreexine_openimlib_create_imagexine_get_pos_lengthxine_newxine_close_video_driverxine_stream_newlibpthread.so.1SUNW_1.2libc.so.1SUNW_1.1libgcc_s.so.1GCC_3.0libxine.so.1libnsl.so.1libsocket.so.1libiconv.so.2librt.so.1libImlib2.so.1libfreetype.so.6libz.solibX11.so.4libXext.so.0libdl.so.1libm.so.2xine_thumbnailer.so/opt/csw/lib/sparcv8plus:/opt/csw/lib:/usr/local/lib:/opt/csw/lib:/opt/csw/lib =' =' y&P |    8@P`p ( d p)    x ( 4)@+L0X.dp|$%14#/2( 6$0<HT`l8x3-5  *7&"!㿠@;@B㿠@㿐#/CЂ`  @  `@@`" `@$@```d``@C{`  +㿐㿐/Cͮ`\ ` @Ce ```h `@CZ㿐㿐@CT @CU* @@CQ  @CN @CJ @CH@CI @CJ 0@C7,`   `4 㿐@C7>>@C2 2 6* .@ `.@ ` .@ @ 8`, `.@ @ 8`*  `  Ԙ `/B'L@B`: 2' 0`L` 8`2 ': 'P'T':'܀ ''' '@BL'Ȁ ?@B`,@B@B @B 'L|'ؓ.`'ĸ  @BؘL''Ԫ@ f@BL  @B @B @@ @'`8@`@@`< R@' H`4@?'𡢉R𕢉H`0@ RΙLJH'𝣈N'L,'  'Ѐ &'@BY-@@BV, @BS?, , L@B+Ԑ? P@?@BF@P"@BET #@B?㿈/A)l`H  D'쑠 @ @`?/A' ''@B @B $ !!L @B`L`P $@B@B@B` @B  $@B '  ``@AݐĒ @A$ @A $@A ~Ġ?'' @A "b'`T 쀤 1 @A #@@ `@A 1 䀣`J  1ܖ @A  #쀣@܀@ @A 1ܖ `T#ؔԖИ@A 2@ئ c$#耥@?'' @A c''@A ?Ȁ @A?bĀ`"c@AO^'@A~ ``$@A{`^$ @AxZ$ Ԁ`ܠ?@A @Ao i'ȚؔԖ@AV̀ ؀ Ԁ` ÛaY@< UbY@MԖ@APĀ?EĀ`"?@A?8'Ȁ "?@@, @(`@(`?@c@ 'Ȫ#,@(` @(`@(`䀥 4+?@@@AȐ@A'@@͐ UbY'@@t'n?p?㿐/@ᐒ @@ ``@@" `@@&` @@`$@@`(@@㿐/@`X@?㿐argb?ae?7KƧ?@N?tj@#9@L%s%s.xine/confignonevideo/mpegvideo/x-ms-wmvvideo/x-msvideovideo/quicktime$00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u -5ANY l cww l oro o h $H ool  $ \ hl     $ \ l t |     ". 7 \B Qa |\ \P  \ l t |w     8 @  P ` p ! ' - 3 9 ? E K Q W( ] dQj x| w  p h  | `  1BM T X Xo|" l$ d 18I OVm " 3ML Y `g { $ &/G.libs/xine_thumbnailer.socrti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__xine_thumbnailer.c.LLC10.LLC11.LLC12.LLC13.LLC14.LLC0.LLC1.LLC2.LLC3.LLC4.LLC5.LLC6.LLC7.LLC8.LLC9old_length.0__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START___dso_handle_endimlib_context_set_anti_aliasimlib_image_set_formatsnprintfepsilon_plugin_initxine_get_homedirxine_close_edataptixine_get_current_framexine_dispose__register_frame_infoepsilon_thumb_imlib_standardizeecore_list_newxine_init_DYNAMICxine_config_load_PROCEDURE_LINKAGE_TABLE_imlib_context_set_cliprectepsilon_generate_thumbusleepimlib_free_image_finimallocxine_open_audio_driverimlib_create_cropped_scaled_imageimlib_image_put_back_data_lib_versionxine_open_video_driver__deregister_frame_infoecore_list_appendi_yuy2_to_yv12imlib_image_get_dataimlib_context_set_imageimlib_image_set_has_alphayv12_to_rgb_etextcalloc_Jv_RegisterClassesxine_close_audio_driverimlib_image_get_width_GLOBAL_OFFSET_TABLE_xine_play.divclipimlib_image_get_height.umulfreexine_openimlib_create_imagexine_get_pos_lengthxine_newxine_close_video_driverxine_stream_newas: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 @(#)SunOS 5.10 Generic January 2005as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482%  : ;  : ; I8  I$ > : ; I$ >  ' I : ; I8 ' I &I< .? : ; I@ 4: ; I 4: ; I.? : ; ' I@ : ; I .? : ; ' @ .? : ; ' I@  : ;4: ;I  4: ;II!I/.? : ;I@ xGNU C 3.4.5xine_thumbnailer.c/home/falko/e/e17/libs/epsilon/src/plugins_Epsilon "hash##src$#thumb%#key&# w'#h'#tw(#th(#charintEpsilon*clong long unsigned intlong intunsigned charshort intlong long intshort unsigned intlong unsigned intlong doubleImlib_Image 'Ecore_Free_Cb.  Ecore_List7k_ecore_list7firstC#lastD#currentE#free_funcG# nodesI#indexJ#Ecore_List_Node:_ecore_list_node:data>#next?#kEpsilon_Plugin_Epsilon_Pluginmime_types #  4# . .@ 3xine_tSYxine_sxine_stream_tTwxine_stream_sxine_audio_port_tUxine_audio_port_sxine_video_port_tVxine_video_port_sdoubleb^_epsilon_xine_param"xine"^#stream"#vo_port"#ao_port"# Kepsilon_xine_param"epsilon_thumb_imlib_standardize")ndst"*hdw"+bdh"+hsw",ash",`s"-%clip"I^val"HXi_yuy2_to_yv12"Snsrc"Qhdest"QEiwidth"Qjheight"Rkstride"Tai"UZj"U\img_y"VEiimg_cb"WE`img_cr"XEX 3ryv12_to_rgb"t nname"s:hw"sih"sbuf"srrp"sx_y"uEl_u"vEh_v"wEd_rgb"xE`__rgb"yEehw"{jhh"{\i"}Xj"}by"Qu"Qv"]r"ag"hb"io"Xjo"Xsx"'fsy"'Tymin"Pymax"Lyt"ret"`dst"HEpti" dnti"hfloat { "dne".fret"`img"wbuf"Ewcnt"`attempts"clength"wpos_perc"wpos_time"wnew_perc"wnew_time"wreq_perc"ereq_time"dold_length" dcfg" {wparam" bdone"try_get_chance"Cclose_stream"w"5wh"5wratio"5wformat"5wxbuf2"jtmp"ka  d epsilon_plugin_init" xnplugin"  \ ../../src/include../../src/lib/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/opt/csw/include/usr/include/usr/include/sys/usr/local/includeEpsilon.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hX11/X.hstddef.hX11/Xlib.hImlib2.hEcore_Data.hepsilon_plugin.hauxv.hdlfcn.hstat.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hinttypes.hxine.hsched.hpthread.hxine/xmlparser.hxine/configfile.hxine/xineutils.hxine_thumbnailer.c"<   4\dlx '  $(,, 488@H\`dhpq q$p.  $(,o48@$D HPPX\ppx3a3a5_3 _$(DP\`ht ut   ,4u8<@ DrLPPuX\ddlxi*j.C V $(,,4Tdhlx| t  ,8HXhpx~~ ,,4<X\\ du&n ((04O4E<O@DXCXQ`dh [ <\\ dtt| -g44<@hhpxnAsS((0DXdx |  -  $ - L -  X - d -  -  ~epsilon_thumb_imlib_standardizeclip%i_yuy2_to_yv12yv12_to_rgb~ptiepsilon_generate_thumb epsilon_plugin_init unsigned intepsilon_generate_thumb.hash.dynsym.dynstr.SUNW_version.rela.got.rela.data.rel.local.rela.plt.init.fini.text.rodata.dynamic.data.ctors.dtors.eh_frame.jcr.bss.symtab.strtab.comment.debug_abbrev.debug_info.debug_line.debug_frame.debug_pubnames.debug_aranges.debug_str.shstrtab ll"o `%B $ $8  /B \ \  DB h h  NllTZ <`*lI8 h$$8q \ \w l l~ t t | | 4   P )W._0:1 ; `HIJY Jy$ J0707010000e3ae000081a40000000200000002000000014551e9090003dc30000000760000000700000000000000000000001700000000reloc/lib/libepsilon.a! / 1162995852 0 0 0 1752 ` fqqqqqqq00000,0HHHHHHHHHHHHHHHHHHHzHzHǰԀԀԀԀ??llepsilon_mime_for_extension_getepsilon_info_freeepsilon_newepsilon_file_getepsilon_resolution_setepsilon_thumb_sizeepsilon_plugin_loadepsilon_existsepsilon_info_getepsilon_generateepsilon_key_setepsilon_info_exif_getepsilon_freeepsilon_initepsilon_thumb_file_getepsilon_info_exif_props_printepsilon_exif_info_getepsilon_exif_info_freeepsilon_info_exif_props_as_int_getepsilon_exif_info_direction_getepsilon_info_exif_props_as_string_getquietMD5FinalbyteReverseMD5TransformMD5UpdateMD5Initepsilon_shutdownEPSILON_EVENT_DONEepsilon_addepsilon_delepsilon_thumb_initepsilon_ipc_client_sendepsilon_ipc_consumeepsilon_ipc_pushepsilon_message_newepsilon_ipc_server_sendcanon_propcasio_propcasio_ifdexifscanexiffreeexifparsereadifdfindspropexif2sbyteexif2bytedebugnewpropexif4bytereadifdsfinddescrhexprintgcdexif4sbytechildpropprognamedumppropexifwarn2exifwarnfindpropexifdiefuji_propfuji_ifdjpegscanjpeginfomakersminolta_ifdminolta_cpropminolta_navalminolta_propnikon_ifdnikon_propolympus_propolympus_ifdflashesplanarconfigsexpmodescenetypescustomrendftypespixelcompsgainctrllightsrcsucommentexpprogscolorspcstagssubjdistorientsscenecaptypeschromposprocessrangechromratioswhitebalcompconfigresunitsfilesrcsimgsensorscompressssaturatemetermodes// 1162995852 0 0 0 44 ` epsilon_thumb.o/ epsilon_thumb_common.o/ Epsilon.o/ 1162995765 0 0 100644 27076 ` ELFfT4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% : ;  : ;  : ; I8  I$ > : ; I : ; I8  : ; ( I !I/ $ >  : ;I' I' I& : ;  : ; I 8 < &I.? : ; ' I@ : ; I 4: ; I .? : ; ' @ 4: ; II4: ; I !I/!.: ; ' I@ ".? : ;' @ #: ;I $.? : ;' I@ %4: ;I&4: ;I '1(41) *.: ;' I +4: ;I,4: ;I -1.41 /: ;I0 U1 U24: ; I? < GNU C 3.4.5Epsilon.c/home/falko/e/e17/libs/epsilon/src/libEpsilon_Exif_Info_Epsilon "hash##src$#thumb%#key&# w'#h'#tw(#th(#charintEpsilon*kw_Epsilon_Info -uri.#mtime/w#w0#h0#1#eei2#long long unsigned intVEpsilon_Info4 _Epsilon_Thumb_Size7 EPSILON_THUMB_NORMAL EPSILON_THUMB_LARGEEpsilon_Thumb_Size< &  long intunsigned charshort intlong long intshort unsigned intuint32_tJ long unsigned intulong_t_off_t&ino_tblkcnt_t&blksize_t&long double w mode_tkuid_ts&gid_twdev_tnlink_ttime_t&timespec&tv_sec'W#tv_nsec(&#timestruc_t>f  Imlib_Image 'Ecore_Free_Cb.Ecore_Hash_Cb1 ##)Ecore_Compare_Cb4BH]##Ecore_List7o_ecore_list7firstC>#lastD>#currentE>#free_funcG# nodesI#indexJ#Ecore_List_Node:8_ecore_list_node:data>#next?8#Ecore_Hash_Node[_ecore_hash_node next#key#value#DEcore_Hash^_ecore_hash buckets^#size#nodes#index# compare*#hash_func#free_key#free_value#]Epsilon_Plugin_Epsilon_Pluginmime_types d#epsilon_generate_thumb #Astatst_dev9#st_pad1A#st_ino#st_mode#st_nlinkG#st_uid#st_gid+# st_rdev9#$st_pad2#(st_size#0st_pad3&#4st_atim#8st_mtim#@st_ctim#Hst_blksize#Pst_blocks#Tst_fstypeQ#Xst_pad4a#h Q&  a  q& dirent d_ino#d_off#d_reclena#d_name#   ")dd_fd%#dd_loc&#dd_size'#dd_buf(# DIR)__FILE ; __FILE_cnt##_ptr$ #_base& #_flag'2# _file(2# __orientation)# __ionolock*# __seekable+# __filler,# 2FILEJ - JMD5ContextX buf #bits J#in Z# Zw  j2 ?MD5_CTX Epeg_Image* _Epeg_ImageEpeg_Thumbnail_Info+  _Epeg_Thumbnail_Info +uri/#mtime0w#w1#h1#2# Evas#E -_EvasEvas_Object#F H_Evas_Object 5Ecore_Evas$Ndouble epsilon_new(?nfile(> `(@h epsilon_free(Vne(U` Pepsilon_plugin_load(f Pnpath(eh(g Phdl_ref(hepsilon_plugin_init(i aj a P V epsilon_init(wni(x`status(y~buf(z vdirs({ vde( 0`type(Xdir( 6b( P`plugin_path( n  0 q " xepsilon_key_set(ne(hkey( i epsilon_resolution_set(^e(Xw(Yh(Zepsilon_file_get( ^e(Q(X{epsilon_thumb_file_get( ne(hi(astatus(~buf( vdirs({v  !epsilon_hash(nfile( [n(Yctx( jmd5out(~hash()~hex(Iuri( v )  92  I  9"epsilon_info_free(n#info(`$"epsilon_info_get(&n#e(%h%fp('"&p((`&im(*(a&info(+ P%len(,'.(M)(M  y*Zepsilon_info_new(+($epsilon_info_exif_get(^#info(X$epsilon_mime_for_extension_get(n#extension(`$epsilon_exists(n#e(h%ok(&i(a&filemtime(a%epsilonmtime(,(~&dirs(~&home( v&buf( n&hash_seed(`'-).$b.0`.;n  *I_epsilon_jpg_mtime_get(/file( +(%im((%info( $epsilon_generate(n#e(a%len(&iw(n&ih(n&tw(c&th(b&outfile( w&mime(Y,( PX&im( (`&info( w0%mtime(9&uri(: o&format(;o,(<n%isedje(=%len(=&tmp(>`%src(?&ee(@b0&dir(h1%evas(K&edje(L W`&pixels(MZ&w(Nh&h(Nc ] !"\epsilon_thumb_size(^#e(X#size(Y l - 2__iob\plugins_mime(%  ../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includeexiftagsEpsilon.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hX11/X.hstddef.hX11/Xlib.hImlib2.hEcore_Data.hepsilon_plugin.hstat.hdirent.hdirent.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hmd5.hEpeg.hexif.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hEvas.hEcore_Evas.hEdje.hauxv.hdlfcn.hEpsilon.c(R     "    o- )" ZS ?RB`d3a,h,h,~~@Y!?LF~?U0.f$A!h<7J  㿐 $ L #``/ @``  &@ 0@"" " " " " " " @!& & & 㿐      @@  @@@㿐@ `  @``'X'\``'`'d)h-hX @ @$@@ `>!?`@ '$@ )X0/@ + @  @  $@@ @0@@ @ ޢ 0@à?@㿐   `" & @& @`:` @ @ 0`@" "   ``'X``'`'\  #  `+h)hX@`$ @@`  ` @&  ( `$@@@@@``  p`0`  **``+@p㿐       @@  @@@ p  @ X @  @  $  `&( `(D ?@` @  @耠`@0۔@ $ &@ $ @   : : :: " <   $ 耢 @$ @$   `  㿐`@ `"`@ `@ ``@ ` `@ ` -;/`'X'\ '` `2 `-@$   @$ qX $L   X$@@L` &@`^ @ X@$ X'h?h$@@` @?h `@?h  `" @?h "  `ޠ )  a @  @   @8P`2D@@ 0 $@ @  " ` " @`" @ `.``@(    @`  `?@` k .@`@ @`   @"Ͱ @ɰ ?@` 2`@` `a  @@ @$@@@А$@ $ @$p'''`̑ JH'@@ d@ @@ M@v @` `T``$```$`@ "V@@`@` B @ @@@@@@@ a .7@@@ b@9`'`̑ JH'  )@ 0@` `@    $@  @`ɠ  ` " " `!Invalid filename given: %s Epsilon expects the full path to file epsilon_plugin_init.thumbnails.thumbnails/normal.thumbnails/large.thumbnails/failHOME%s/%s/usr/local/lib/epsilon/plugins/.so/usr/local/lib/epsilon/plugins%s/%s/%s.jpg0123456789abcdeffile://%sjpgmpgmpegvideo/mpegwmvavivideo/x-ms-wmvmovvideo/x-msvideovideo/quicktimelargenormalfail/epsilon:%dx%d%s%s/.thumbnails/%s/%s.jpg%s:%sedjKey required for this file type! ERROR!! Cannot create buffer canvas! ERROR! image/edjeimage/%sCannot load file %s, group %s |  -  - @ -  - T -  8  -  -  -  -  ( - t -  -  4^ uepsilon_new epsilon_free epsilon_plugin_load gepsilon_init tFNV^iqy 4488@P \`x#|+3;CKS[cks{ @DDLTT\ d h h p (x 0| 8| @ H P X ` h p x                 @  T  p  |     " , 4 < D  L  W  _ $ g $ o , w 4  <  <  D  L  P  P  \  t             $ , 4 < D  L  T 0 \ H d X l X t ` | l                 $  4  @  @  H  | ! ) 1 9 A I Q Y a i q y         $  ,  8  H  H  P  \  l  t  |       # + 3 > F P4 XP `X ht p x              04 8 < H.L T5GHHHHH098 H< HLJl `p pt `x p      ?  W0E 7 E  R7     )$ , 8 <LP` d#|  W:+ PL64GDH p p      ?   W,0XG 8 8WKB    G`HhHHHY, H4=8 HH\3t$//5 GG` Pd Ph=p X| X ` `= p p= x  x =    =     $ ( , 0 4 l p5  W< H  ?  ,  0  8W H  X  hW t0   >   >   > 0  ,3 D$ \  `  lW x<  0    >   41 < H L- P x   H =  H          G  ?      W H 3 ,&  M 8 T Q $ S   F  H $; ,N < T2 dC l t' |Z @ !  p  p W ! "     W $4 8 D.H P X d(h t x . H 0 4L P(h lh  \   p   0 44@ D\\ `x |  as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54  >%] 1&475?7L9hb\: k:Py;:/;l;lAE  Ht  Y0 @  dp  e  e  f?Epsilon_Exif.o/ 1162995767 0 0 100644 11100 ` ELF'4(.shstrtab.debug_abbrev.debug_info.debug_line.text.data.rodata.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; ( &I : ; .? : ; ' I@ : ; I 4: ; I4: ; I .? : ; ' @ 11 1 41 .: ; ' : ; I U.: ; ' I 4: ; I? < 4: ; I?  GNU C 3.4.5Epsilon_Exif.c/home/falko/e/e17/libs/epsilon/src/lib__FILEi(__FILE_cnt#(#_ptr$/#_base&/#_flag'5# _file(5# __orientation)F# __ionolock*F# __seekable+F# __filler,F# int5unsigned charlong long intFILEJ[long intcharint16_t <short intshort unsigned intlong long unsigned intlong unsigned int}long doubleu_int16_t8u_int32_t9F ;order LITTLE BIGexifprop,tag#type#count #value #name# descr#str#lvl#ifdseq(#ifdtag# override#"subtag#$next%#( };exiftagsprops%#tifforder#btiff/#etiff/# exifmaj#exifmin#mkrval#mkrinfo# Epsilon_Exif_Info\_Epsilon "hash##src$#thumb%#key&# w'(#h'(#tw((#th((#Epsilon*_Epsilon_Info -uri.#mtime/#w0(#h0(#mimetype1#eei2#Epsilon_Info4k wepsilon_info_exif_props_as_int_get(^eiwXlvlYpropjZnlist%Xpas( epsilon_info_exif_props_as_string_get5^ei3wXlvl3Yprop4jZn6list7%Xpas8(repsilon_info_exif_props_print]nei\whrhY_epsilon_exif_info_props_getflistd%lvldpase(ng xepsilon_exif_info_getnexbfp~amodeeeihldhhX `b\^$epsilon_read_exif_datafp~dumplvl(pas(mark(gotapp1(first(lenFrlenFexifbuf/t$+bepsilon_exif_info_free^eeiXepsilon_exif_info_direction_get^exXeeiYerrno((quiet (C /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysexiftagsstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hEpsilon.hEpsilon_Exif.cerrno.h$) q$ .q l)u !A`2[#q#q/e#e#q/e#q/e#qu>\6^5_5\8,H#d ?  "/?  "+? !*`0`*0`` `?`@`? * 2 *0`@ " ( "? ` 2 ?@ 2 (  "3   "/  !*`0`*0`` `?`@`? * 2 *0`@ " ( "  ` 2   @ 2 ( ` 㿐 n  j f b"?צ`'c!*0`` `?`@`? * 6 *0``"   ( I ` 6 `" $" @4)" @6  @"  (@aa2 (      @ ( @   @6 @`8 ( @2 (  @b"@㿈@`@ h    '  `?@耢  쀠`@  " @@  `?@耢 쀥  @0C@蠒 " @耢2(@ `2 @ @ "ް @ڰ @@ @耢ޒ@ @ư @`@@ ` : %s%s%s %s%s%d rberror reading JPEG (length mismatch)couldn't find Exif data |   -  -  $ epsilon_info_exif_props_as_int_get}epsilon_info_exif_props_as_string_getepsilon_info_exif_props_printepsilon_exif_info_get*epsilon_exif_info_freebepsilon_exif_info_direction_getquiet8D(unsigned int    .hDJX$agn| 5?GEpsilon_Exif.cepsilon_info_exif_props_printepsilon_exif_info_getfreadepsilon_exif_info_freefopenprintfepsilon_file_getepsilon_info_exif_props_as_int_getmallocepsilon_exif_info_direction_getfclosejpegscanexiffreeerrnofreeexifwarn2exifwarnstrerrorfseekepsilon_info_exif_props_as_string_getexifparseexifdiequiet Gw#'+/hFJ``d`hX&*8>JXN||#  4XX`htt |%-5=EMU]emu  (0<<DTdpx|| #+3=EMU ],e,m4uDT`l  !)3$;,E0M0W8_@ihqly||"$,$4,<0D0L8TD^LfPnPvX~hppx ( X(X0d8|@       lt x |  "8D`t |! H H "  ( ,0 8Dd h  $ (4 8P Thl pX| |as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54  ?% G17\=``ERHb0 qPh x@ M8  @  $  &  '  '  '?md5.o/ 1162995770 0 0 100644 10712 ` ELF&4(.shstrtab.debug_abbrev.debug_info.debug_line.text.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ > $ > : ; II!I/  : ;  : ; I8 .? : ; ' @ : ; I 4: ; I  I &I U.? : ; ' @ 7GNU C 3.4.5md5.c/home/falko/e/e17/libs/epsilon/src/libcharshort intintlong long intunsigned charshort unsigned intuint32_tJRlong long unsigned intlong intlong unsigned intlong double\MD5ContextX buf #bits \#in l#l|?MD5_CTX  byteReverse ^ buf X longs RY t Q  MD5Init .^ ctx -X | mMD5Transform n buf mh in si a g b f c e d d  y MD5Update =n ctx <c buf <b len <R` t >a p LX  MD5Final mn digest lh ctx li count nR\ p o]* /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/sys/usr/include/usr/include/sysiso/string_iso.hint_types.hmachtypes.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hmd5.hmd5.c 1~*n  (` @ +`@ (`@ " H;jcc"" &. ``v" " " " 㿀   @@@@@5ک@`x@5-@@`@'@:1@cV@5 - @@`@@  @`۪@5`-`@@@` @@0os@b@5 -@@@`@'@=_@c@5-@@`@@ @b*@5 - @@`@@* @b@5`-`@@'@`@@ ?Q@a@5 -@@@` @@ `&@`خ@5-@@`$@@"=@c@5 - @@`(@@ ?ֺ@c@5`-`@@@`,@@"W5@c@5 -@@@`0@@@a"@5-@@`4@@ ?f@a@5 - @@`8@@)P@c@5`-`@@@`<@@m@`!@5 -@@@@;=@ab@5-@@@@;0,@c@@5 - @@@@; @bQ@5`-`@@@@@@;:m@c@5 -@@@@ ;5Ă@`]@5-@@@@ ;@`S@5 - @@@@;6(y@b@5`-`@@@@@@;9@cȬ@5 -@@@@;xs@a@5-@@@@;0@c֨@5 - @@@@;=5C@a@5`-`@@@@@@ ;V@`@5 -@@@@ ;*x@a@5-@@@@;?;@c@5 - @@@@ ;@b٪@5`-`@@@@@@;#J@`@5 -@@@ ;?@aB@5-@@@ ;!}@b@5 - @@@;gX@a"@5`-`@@@@@;?yN@` @5 -@@@;)/@bD@5-@@@;@c@5 - @@@ ;=҂@c`@5`-`@@@@@ ;/@`p@5 -@@@ ; &߂@bƮ@5-@@@;:I@c@5 - @@@;5;̂@`@5`-`@@@@@;"@a@5 -@@@;6u4@`9@5-@@@;9@a@5 - @@@;蟂@`@5`-`@@@@@;1+@be@5 -@5@@;= H@bD@5-@5@@ ;ʿ@c@5 - @5@@;*@c@5`-`@@5@@@ ;?$@`9@5 -@5@@;Vւ@aî@5-@5@@;#3@`@5 - @5@@ ;?@`}@5`-`@@5@@@ ;!a@aѬ@5 -@5@@ ;@bO@5-@5@@;?9@b@5 - @5@@;(P@c@5`-`@@5@@@ ;@a@5 -@5@@;=߂@b@5-@5@@;/N@b5@5 - @5@@ ; @b@5`-`@@5@@@;:ᴂ@c@5 -@   @& @&& & 㿐 .@@& 4 `4 @4`$`? @ @`@@@ @$ ? @@@ @? ?@@ 㿐`0``?@  ? @ ?+`` `  @@ @&`&`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D&`H&`L?@ `@ ``&`P&`T@@ @ &@ |  @ < < -  -  - V;byteReverseMD5InitMD5Transform~MD5UpdateMD5Final  ( Xunsigned int   @#| <07 A@<md5.cMD5FinalbyteReversememsetMD5TransformmemcpyMD5UpdateMD5Init S@@||!    (",*020:@B@JDRHZLbPjTrXz\`dhlp|0d " *<2p:BJ R@Ztbjrz@p0d$T@l "$*P2|:BJ R ,Z Xb j r z  8 d     D p    $ T |       " * 2 : B J U ] e m u }              ( 4 D P T X \ \' d/ t7 ? G O W _ g o w          L\hlptx'  , <  H l x     P ` | $(@48|PT lp as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 1;%4.1 d7DZT cq& |4 TI  l  %  %x  &T  &`  &x?/0 1162995773 0 0 100644 18272 ` ELFC4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ > $ >  I : ;I: ; : ; I ' I  : ; : ; I8 : ; I8 <  : ; I 8 : ; I : ; .? : ; ' I@  : ; .? : ; ' I@ .: ; ' I@ : ; I : ; I .: ; ' @ 4: ; I 4: ; I4: ; I  .? : ;' I@ : ;I : ;I 4: ;I !4: ;I "1#41 $ U% U&41'.: ; I ( )I*!I/ +.? : ;' @ ,4: ; I? < -4: ; I?  GNU C 3.4.5epsilon_thumb.c/home/falko/e/e17/libs/epsilon/src/liblong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doublepid_tcEcore_Event_Handler lEcore_Free_Cb.JP \ Ecore_List7n _ecore_list7 firstC<# lastD<# currentE<# free_funcG5# nodesI# indexJ#Ecore_List_Node: 6_ecore_list_node: ># next?6#\doublefloatoEcore_Con_Server*Cy_Ecore_Con_ServerEcore_Con_Event_Server_Data*U _Ecore_Con_Event_Server_Data *U server*v# *w# size*x#aEpsilon_Request,"! _Epsilon_Request," id,&# size,'# status,(# path,)# dest,*# ,+#__FILE/ a__FILE/ _cnt0## _ptr0$[# _base0&[# _flag0'o# _file0(o# __orientation0)# __ionolock0*# __seekable0+# __filler0,# Epsilon_Message5x _Epsilon_Message5 head5# nid5# mid5# status5# thumbsize5# bufsize5# cl5#Epsilon_Client5"#d 5" buffer5%# bufsize5&# offset5'# _Epsilon 6" hash6## src6$# 6%# key6&# w6'# h6'# tw6(# th6(#Epsilon6*depsilon_thumb_init7&ninit_error7dcon_init_error7bqueue_error7`handler_add_error7^handler_del_error7\handler_data_error7Zevent_type_error7Xepsilon_shutdown7mn5epsilon_cb_server_add7}n7|htype7|ievent7|jepsilon_cb_server_del7n7htype7ievent7jepsilon_event_free7n7hev7i7i yepsilon_cb_server_data7n7htype7ievent7je7ymsg7h7jtb7`a nepsilon_add7"npath7!edst7!isize7!j7!k 7#h!msg7$`" K n# b# a# }$# b# a# }% Z& $!tb73`' epsilon_client_connect7retries7buf7sockname7 (child7) *\+ epsilon_del7[n7Zh!temp7\X,ECORE_CON_EVENT_SERVER_ADD*,ECORE_CON_EVENT_SERVER_DEL*,ECORE_CON_EVENT_SERVER_DATA*-EPSILON_EVENT_DONE7 ) *\,__iob1 debug7epsilon_init_count7epsilon_mid7epsilon_request_queue7Bepsilon_server7buffer7epsilon_server_add7 epsilon_server_del7 epsilon_server_data7   ../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hEcore_Data.hsocket_impl.hun.hnet/if_dl.hnetinet/in.hmachlock.hmutex.hrwlock.hsemaphore.hcondvar.hrwstlock.hcred.huio.hresource.hvm/seg_enum.hkstat.hvmem.hkmem.havl_impl.havl.hvnode.hpoll.hmodel.hstrft.hstream.hnetconfig.hsocket.hnetdb.hEcore_Con.hEcore_File.hEpsilon_Request.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hepsilon_private.hEpsilon.hepsilon_thumb.c79OE8`4`(`#q#q#q#qdF-m)O[`&"r"m'Q-;Z)o㿐@ M @ E1 `0@# 9$```@ ' -$``@ % !$``@ ! $ @  `` `#`#`@ `& @ @@@`@@ 㿐1 `& @`@`@`@`@@ 㿐`` @ 㿐` ` `@ 㿐`  ` @@@@`㿐%` `@ Y' @ `@ N'@@ E`!@  @@`@ 2`@ 0  @ !@`` `@@@ &@@& 㾐'`2!@@!@!) `h` ab   @ 7$@` `2T`h @  @`I& @& ` ` `& @ I``$ @ m @ G@``0@ @ P &`@0H@ @ @@@@ & @@,   @ @ @&  `@ ``2  @ @ 0@ 0@ 㿐!@  @`0@`@@ 2!! client connected to server !!!! client disconnected from server !!Receiving dataReceived %d response for %s %s-%sepsilonsocket name %s connect to ipc server: %p Failed to connect to server !! requesting thumbnail for %s !! First childSecond child/usr/local/bin/epsilon_thumbdexeclp | L - h - , - 4 - L -  -   - \ - q epsilon_thumb_initepsilon_shutdownepsilon_add epsilon_del EPSILON_EVENT_DONElddPEpsilon_Ipc_Endunsigned intthumbdata, ' 3  F L   S g z     L4` +Lh<AZmty %6IP_fy ).=\IPhL{epsilon_thumb.cepsilon_cb_server_addepsilon_midepsilon_server_deldebugbufferepsilon_server_dataepsilon_server_addepsilon_request_queueepsilon_init_countepsilon_serverepsilon_event_freeepsilon_cb_server_delepsilon_cb_server_datacallocecore_dlist_current__iobecore_event_handler_delepsilon_shutdownputsecore_con_server_connectEPSILON_EVENT_DONEusleepexitECORE_CON_EVENT_SERVER_DELecore_dlist_appendepsilon_newepsilon_ipc_consumeecore_shutdownprintfECORE_CON_EVENT_SERVER_DATAecore_event_type_newecore_initepsilon_addecore_dlist_nextecore_list_destroyfwriteecore_con_initperrorepsilon_thumb_sizemallocepsilon_ipc_pushECORE_CON_EVENT_SERVER_ADDecore_con_shutdownecore_dlist_removeforkepsilon_existsepsilon_message_newecore_event_addstrdupecore_event_handler_addfreeecore_list_newepsilon_delexeclpepsilon_ipc_server_sendepsilon_thumb_initgethostnameepsilon_freesnprintfepsilon_initepsilon_thumb_file_getecore_dlist_goto_first  l]###(L(@>8Q0j( L #W[b#`#` #LPUbf#   . P( [@  l  !    1  M a   ,@HLLTptt| (08@HPX`hpx (08@LPht (08@HPX ` h(p8x@HPX`dppx $ , 4 <(DHNXV`^hflnlx|| ( 0(8,@@HTPpZbjrz(,,'4/<7<?DG\OdZpbtl|t~ ,4 8 8 @ H !P )X 1` ;x C K V ^ f n v ~    ( 4 D P \ \ l,1, 0 @@D P T6 X \6 ` d>l x |$  $  >  *  `*  `> +! !    H      $ (/, 078(P T d h lp t x|    / 7(        (  ( 8?@?H?P?d h t x   P P    5'   ` J  .  (! , 0! 8 <<P)T `\ `8d p! !  ! &:IF! =  E4  $ , 0 8G@ D P T |  ?      ==    ;0 4 D HCd9|"  )  C  %)  )   &:$3,I@FL P?` d h p0x#=  9    (B ( H2 H   ( J (., D H8PT 04LLPhl`as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54  >t % 1Tl7 O?"L#u\#u k#Xy#($,$(,  / 0  8   B  C  C  C?/17 1162995776 0 0 100644 7464 ` ELF4(.shstrtab.debug_abbrev.debug_info.debug_line.text.data.debug_frame.debug_pubnames.debug_aranges.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ > $ >  I: ; I<  : ;  : ; I8 : ; I  : ; .? : ; ' I@ : ; I 4: ; I4: ; I  .? : ; ' @ GNU C 3.4.5../../src/common/epsilon_thumb_common.c/home/falko/e/e17/libs/epsilon/src/liblong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubledoublefloatEcore_Con_Server*CQ_Ecore_Con_ServerEcore_Con_Client*D}_Ecore_Con_Cliente9Epsilon_Message3=_Epsilon_Message3head3#nid3#mid3#status3# thumbsize3#bufsize3#cl3N#Epsilon_Client= 3"_  3"buffer3%#bufsize3&#offset3'# Tepsilon_message_new4 Tn nid4 b path4 i dst4 j status4 k size4 msg4 Thdstlen4 `pathlen4a body4 epsilon_ipc_client_send44^ cl43X msg43TY epsilon_ipc_server_send4;^ srv4:X msg4:TY jepsilon_ipc_consume4ETn end4Djcremains4Famsg4GTbsize4K`msg24LThTepsilon_ipc_push4wn end4vjh data4vi size4vjmid41e ../../src/common../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hsocket_impl.hun.hnet/if_dl.hnetinet/in.hmachlock.hmutex.hrwlock.hsemaphore.hcondvar.hrwstlock.hcred.huio.hresource.hvm/seg_enum.hkstat.hvmem.hkmem.havl_impl.havl.hvnode.hpoll.hmodel.hstrft.hstream.hnetconfig.hsocket.hnetdb.hEcore_Data.hEcore_Con.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hepsilon_private.hepsilon_thumb_common.c4 "u      㿐`  @ @ @  ``#`;c["" " " " ` @ @````㿐   `@$@@ @`@$ @$$$㿐`   @  @  @ @ @& @& & @&  & &  |  -    -  - epsilon_message_newZepsilon_ipc_client_sendepsilon_ipc_server_sendepsilon_ipc_consumepepsilon_ipc_push$Epsilon_Ipc_Endunsigned int  #;Qelepsilon_thumb_common.cmidstrlenepsilon_ipc_client_sendecore_con_client_sendepsilon_ipc_consumememcpyecore_con_server_sendmemmovemallocepsilon_ipc_pushstrcpyepsilon_message_newreallocfreeepsilon_ipc_server_send $uUd>\BDH$r| (,,4@DPTT\l x|$,4<DLT\dlt|  (,0&8.@6D>HFHNPVP^Xf\ndvl~ptx&.$ 4 DX \ h      8Pd04@DPTlpas: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 )%51 $7<=@JZS ist |0  (  H  ,x      ?canon.o/ 1162995852 0 0 100644 34192 ` ELF4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 : ; I8 &I .: ;' I@ : ;I : ;I 4: ;I 4: ;I I.: ;' @ .? : ;' @ 4: ;I U4: ; I? < I!I/ 4: ; I wGNU C 3.4.5canon.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintjunsigned charlong long intlong intcharint16_t <short intint32_t =]short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9{sorderLITTLEBIGPexifprop, tag3# type3# countD# valueD# nameP# P# str# lvl# ifdseq]# ifdtag3# override3#" subtag#$ next[#(V sexiftags props[# tifforderU# btiffd# etiffd# exifmaj# exifmin# mkrval# mkrinfo#+descrip> val?# @P#exiftagF tagG3# typeH3# countI3# lvlJ# nameKP# LP# tableM#ccstm 4 val5# 6P# table7# Lcanon_prop01t]n r[h r[ioffrjosUkvu3X canon_prop04]^ [X [YoffZoU[ canon_propA0]n [` [ioffjoUk canon_subval]n [htisubtagsjvalfunki]bj]Qv3`[aoffda+]fcanon_customn [hoffioUjtablefki]fj]dcnPacvev3Q[b)canon_propan `[ht`aib{`offsetc`vd3flmind3bflmaxd3kflunitd3itmpprope[`oncex]errno(]debug]Wcanon_macro=Gcanon_focustypeFpcanon_qualityRcanon_flash\canon_fbiask*canon_driveScanon_focus1C}canon_imageszm canon_shootcanon_dzoomcanon_range #canon_iso  Jcanon_meter : scanon_expmode c  canon_whitebal  + canon_tags  +canon_tags01  +canon_tags04V  I+canon_tagsA0j 9 tccstm_offont d ccstm_shutterz  ccstm_disen  ccstm_explvl  ccstm_autooff  Kccstm_shutspd ; wccstm_aebseq g ccstm_shutsync  ccstm_lensaf  ccstm_endis  $ccstm_menubut  Pccstm_setbut @ {ccstm_yesno k ccstm_onoff  ccstm_afsel  ccstm_afill  #ccstm_lcdpanels  Qccstm_usmmf A {ccstm_explvlinc k ccstm_tvavform  ccstm_shutterael ccstm_afspot 0ccstm_afact Zccstm_regafJccstm_lensaf1tccstm_aisens&ccstm_fscr/ccstm_finder5/canon_d30custom>]canon_1dcustomTM  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hcanon.cerrno.hE N+,W<[ *n b h'9  &k)j3p""s ])$q(u >Vo&2coC>Q.B% F@[+㿈V $/`  `%+` @  `@ ?䀢 Tb 6  * 2`@?``6 @ r&  @`* 2 @  (`u * `2q @*  "j   T+ i m+ +  e d+ + + \ * 2` @?```6 `@2`& K `@ ?• `'6 "? ``$@ -& @J* 2 '('@H* 2 '쑢 (?`  @  (``@@@ `@@@ϒ,R $`` "    ?`2 "  @?``2  㿐V $/% `  @`  $ `  @  (`  @@@㿐` @/@`*  2 @ `@f `H ;-?c``@@, 4 2 $" @  @ ``@ (``(``$` `` `$` 4`@   2``  @æ @4 $`@  $`4 ` @`(`@@@4 㿈/@*  2 @ ? @ * @ 2 `@` ;9``''` `@(`@4"    " " 2 2 $@ ^?  4   `  @? ` @(`  .4 @ ` @@ 7$@ 8 @ @ @@ @@  @`0!@ `Ҫ@ 4 `4@@@(`  4 @@@ƀ㿀V $/ڮ  L ?`c  "@ ` @ 5`&  `` &   6 ``@ ` X``"``2Y ``    `8 .`0``(``@`` " " @ $ ,.0`3`@"'''왠'쑠쑢 ('앢애*?`#\  @  4 "9`X`` ` @  % ` @`* 2@   @8 0`@ q$`` `` `@2 @ \&  # c@c@` @  m(`2 ``  _ @@  Y ` U @ O @M4 @  & `  @ ``@@@``@ .`@ 0 2@`#`@@@ `@@@+,'쑠애 (?`  @  4 Focusing screenFinder display during exposureShutter release w/o CF cardISO speed expansionShutter button/AEL buttonManual Tv/Av for MExposure level incrementsUSM lens electronic MFTop/back LCD panelsAEB sequence/auto cancellationAF point illuminationAF point selectionMirror lockup# AF points/spot meteringFill flash auto reductionShutter curtain syncSafety shift in Av or TvAF point activation areaSwitch to registered AF pointLens AF stop buttonAI servo tracking sensitivityUnknown functionStandardSlowModerately SlowModerately FastFastUnknownAF StopAF StartAE Lock While MeteringAF Point: M->Auto/Auto->CtrAF Mode: ONESHOT<->SERVOIS StartAssist + AFAssistOnly While Pressing AssistSingle AF PointExpanded (TTL. of 7 AF Points)Automatic Expanded (Max. 13)1st-Curtain Sync2nd-Curtain SyncEnabledDisabled45/Center AF Point11/Active AF Point11/Center AF Point9/Active AF PointH=AF+Main/V=AF+CommandH=Comp+Main/V=Comp+CommandH=Command Only/V=Assist+MainH=FEL+Main/V=FEL+CommandOnOffOn Without DimmingBrighter0,-,+/Enabled0,-,+/Disabled-,0,+/Enabled-,0,+/DisabledRemain. Shots/File No.ISO/Remain. ShotsISO/File No.Shots In Folder/Remain. ShotsTurns On After One-Shot AFTurns Off After One-Shot AFAlways Turned Off1/3-Stop Set, 1/3-Stop Comp1-Stop Set, 1/3-Stop Comp1/2-Stop Set, 1/2-Stop CompTv=Main/Av=ControlTv=Control/Av=MainTv=Main/Av=Main w/o LensTv=Control/Av=Main w/o LensAF/AE Lock StopAE Lock/AFAF/AF Lock, No AE LockAE/AF, No AE LockYesNoNo Viewfinder DisplayFinder Display OnEc-N, REc-A,B,C,CII,CIII,D,H,I,LLong exposure noise reductionShutter/AE lock buttonsTv/Av and exposure levelAF-assist lightAv mode shutter speedMenu button return positionShooting Set button functionSensor cleaningSuperimposed displayNot AssignedChange QualityChange ISO SpeedSelect ParametersTopPrevious (Volatile)PreviousOperate AFLock AE & Start TimerAuto1/200 (Fixed)1/2 Stop1/3 StopAF/AE LockAF/AF LockAE+Release/AE+AFCanonColorTempColor TemperatureCanonUnknownCanon TagA0 UnknownCanon4LenCanon Tag4 LengthCanonWhiteBWhite BalanceCanonSequenceSequence NumberCanonAFPoint2Autofocus PointCanonFlashBiasFlash BiasCanonSubjDstSubject DistanceCanon Tag4 Unknown0 EV0.33 EV0.50 EV0.67 EV1 EV1.33 EV1.50 EV1.67 EV2 EV-2 EV-1.67 EV-1.50 EV-1.33 EV-1 EV-0.67 EV-0.50 EV-0.33 EVDaylightCloudyTungstenFluorescentFlashCustomBlack & WhiteShadeManual TemperatureCanon1LenCanon Tag1 LengthCanonMacroModeMacro ModeCanonTimerLenSelf-Timer LengthCanonQualityCompression SettingCanonFlashModeFlash ModeCanonDriveModeDrive ModeCanonFocusModeFocus ModeCanonImageSizeImage SizeCanonShootModeShooting ModeCanonDigiZoomDigital ZoomCanonContrastContrastCanonSaturateSaturationCanonSharpnessSharpnessCanonISOISO Speed RatingCanonMeterModeMetering ModeCanonFocusTypeFocus TypeCanonAFPointCanonExpModeExposure ModeCanonMaxFocalMax Focal LengthCanonMinFocalMin Focal LengthCanonFocalUnitsFocal Units/mmCanonFlashActFlash ActivityCanonFlashDetFlash DetailsCanonDZoomResZoomed ResolutionCanonBZoomResBase Zoom ResolutionCanon Tag1 UnknownEasy ShootingProgramTv-PriorityAv-PriorityManualA-DEPDEPClose-Up (Macro Mode)Infinity ModeLocked (Pan Mode)EvaluativePartialCenter-Weighted50100200400NormalHighLowFull AutoLandscapeFast ShutterSlow ShutterNightSepiaPortraitSportsMacro/Close-UpPan FocusLargeMediumSmallOne-ShotAI ServoAI FocusSingleContinuousRed-Eye ReductionSlow-SynchroRed-Eye Reduction (Auto)Red-Eye Reduction (On)External FlashFineSuperfineMacroCanon1TagCanon Tag1 OffsetCanon4TagCanon Tag4 OffsetImageTypeImage TypeFirmwareVerFirmware VersionImgNumImage NumberOwnerNameOwner NameSerialSerial NumberCustomFuncCustom FunctionCanonA0TagCanon TagA0 OffsetCanon UnknownNonex2x4%d secx%.1f%d KCanon maker tag appears corruptnum %02d, val 0x%04XCanon custom tag appears corrupt%s - %s%s %d - %dProcessing Canon Maker NoteCanonLensSzLens Size%.2f - %.2f mm Unknown (%d): %d, 0x%04X %03d-%04d%010d%.2f mm      ,04@     $%      |  -  T -  -  - \ - {lcanon_prop , T t propdescrapropunsigned int H" (.5 C  O l@ \Ph ht\  H( 0  (H` "880 @>M0Zhg sH( ((T  D0( X p(+ t 7p C S ,_ k w  L p((( X ( %4D DO`(\fms}\canon.cccstm_offoncanon_customccstm_afsel.LLC27canon_qualitycanon_drivecanon_focus1ccstm_yesnocanon_shootcanon_propA0ccstm_fscrcanon_flash.LLC280.LLC281.LLC282.LLC283canon_iso.LLC284.LLC285.LLC270.LLC271.LLC272.LLC273.LLC274.LLC275.LLC276.LLC277.LLC278.LLC279ccstm_lensaf1canon_expmodeccstm_shutsyncccstm_aisensccstm_finderccstm_disenccstm_afillccstm_lensafccstm_autooffccstm_tvavformccstm_afspotcanon_prop01canon_prop04canon_dzoomccstm_endiscanon_focustypeccstm_lcdpanelsonce.0canon_whitebalccstm_aebseqcanon_meterccstm_regafccstm_explvlinccanon_macroccstm_usmmfccstm_afactcanon_rangeccstm_explvlcanon_imageszccstm_setbutccstm_shutteraelcanon_fbiasccstm_menubutccstm_onoffccstm_shutspdccstm_shuttercanon_tags01canon_tags04canon_subvalcanon_1dcustomcanon_d30customcanon_tagscanon_tagsA0findspropstrlen.uremexif2bytedebugputscanon_propprintf.udivfinddescrmallocstrcmpchildproperrnodumppropfreeexifwarnstrerror_GLOBAL_OFFSET_TABLE_snprintfexifdie' ;2 2|      22   f2j2\q   2\2   2 2'   22 X  22  #8lA6I?i F 4 D 6 _> # 9 T O 5P `U  N ) E 7- cM = $ , 5 <J gG  K  + =7 gB @ . H/FCp?"%&ISvR22 222 2 2D2L2`2d2h2h 2p2x2$2,242<2D2N2V2H^2Ph2hp2lx2l2t22222222222222d2p2222&2.262>2 F2(N24V2<^2Pf2\n2`v2d~2t2x2|2|222222222222 2,2,242@2H&2p.262>2F2N2V2^2f2n2v2~2222 2 22 2@2@2H2X2l2t2222 222$2.262>2@F2@N2HV2X^2f2n2v2~2222222222222242H2H2P2T222&2.282@2H28P2LX2Xb2`j2xr2z222222222222 2 2 2 2 2 2  2 2 $2 $$2 ,,2 @42 @<2 HD2 TL2 pT2 p^2 f2 q2 y2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 02 D2 D 2 L2 2 !2 )2 42 <2 G2 O2 W2 _2 g2 (o2 Dw2 \2 h2 h2 t2 2 2 2 2 2 2 2 $2 02 02 82 ` 2 ` 2 h 2 2 2 (2 02 82 @2 H2 P2 X2 `2 h2  p2 z2  2 $ 2 4 2 H 2 d 2 l 2 2 2 2 2 hh(hh,hlLP Xa`^ iYt4x4 _ a4`YYDH \ipctc |gjcc gjhhph`cc  igjhhY04 8fTcXdc h tYbdt_`igjhhY YDH Pfdhclpt xc   YbdTWlWx`WWie_W0i8WhgpjhhTT Z Z ,8 08 D  Ld tP O 0 O 0 b !  !  `   i R S Z  $ <Y T] t x[ 1 P 1 R ` ^ X   i 8U <  @U D lV V `   i S c c g j  Y (Y 8Y Hc Lc Tg \j lc pc xg j   i<<&<0 (<P, 4<h8H@<D.L<P@X<\Bd<h7p<t=|<+<(<@)<P/<p5<$<5<C<?<"< %<@ <X<h<p$<,<4<<D<L<T<\<d<lt< |<0<8<X<h<<<<<<<< <8 <<$<P,<h4<<<DL<T<\<d<lt<|<< <0<@<X<p<<<<<<<8<X <p<<$,<4<<<D<LT<\< dl<(t<@|<X<`<<N<@)<E<-<M<=<$<,<p 5<J < $G,<@0)8<P<KD<0H P<@\<d<lt<h|<x<<<<<<<<< < < < < (< 8$< H,<4< X<< hDL<T<\h< l< |< < < < < < 9< < (< 8< H< X< hI< x< <  < <  < (< 0< 8< @< H< P< X< `< h< p< x< (< 8< @< P< `< < p< < < < < < < < < < < <  A,< 00< @@< XD< hHT< X< \h< l< p|< <  < < F< <  < < 0< @< PD< `< pD< < D<  < <  < $>0< 4< 86D<H< HX<\<(`#l<8p<H<`<p<<<<<<<<<< < <8 <P <` <h <x (< 0< 8< @ H< P<  X< `< h< p x< < <  <  < < < <  <( <0 <8  <@ < <P <` <p < < < (< 0< 8< @< H P< X< `< h p< x< < < < < <  < <  < <  < <( <@ <P <p <  <( < < ( 0< 8<( @ L< P< `< d< t< x< <( <8 <P <X <h <x < < < < < < < <  < $< ,< 4< <320342@3D2\\3`2x3|232((2as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ c_{%= 1 7)0?>( @OJh\K!lK5 {KUKmKKVR<VL Z<  f0 n  l   x  &?casio.o/ 1162995852 0 0 100644 10468 ` ELF%$4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I 11 4141  U4: ; I .: ; ' : ; I4: ; I.? : ;' I@ : ;I 4: ;I 4: ; I? < GNU C 3.4.5casio.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintjunsigned charlong long intlong intcharint16_t <short intint32_t =]short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9{sorderLITTLEBIGRexifprop, tag3# type3# countD# valueD# nameR# descrR# str# lvl# ifdseq]# ifdtag3# override3#" subtag#$ next]#(X sexiftags props]# tifforderU# btiffd# etiffd# exifmaj# exifmin# mkrval# mkrinfo#/descrip> val?# descr@R#exiftagF tagG3# typeH3# countI3# lvlJ# nameKR# descrLR# tableM#field \ tag]# type^# count_ # value` #  j  j eifd f tagg3# numh3# fieldsie# nextjk# !casio_propnprop]ht!i'<HQZYdyYonce]cdcasio_prop1prop]t!i]v3casio_prop0prop]t!i]v3casio_ifdknoffset Dht !imyifdkldebug]  casio_record2 ; casio_qual>+ c casio_focusHS  casio_flashS|  casio_intense^  casio_whitebh   casio_sharpu 3 casio_range# \ casio_sensitiveL / casio_tags0y / casio_tags1l /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hcasio.c em'm@C?U?  㿐V`/`-`?c   `& `` `&  ,6 `@ 8``"+@ `?c  ނ `& `` `&  6 *`@2``@  & `@V` $㿈`/@` @    @6``@@CasioASCII1Casio ASCII Val 1CasioASCII2Casio ASCII Val 2CasioASCII3Casio ASCII Val 3CasioUnknownCasio UnknownCasioRecordRecording ModeCasioQualityQuality SettingCasioFocusFocusing ModeCasioFlashFlash ModeCasioIntensityFlash IntensityCasioDistanceObject DistanceCasioWhiteBWhite BalanceCasioDZoomDigital ZoomCasioSharpSharpnessCasioContrastContrastCasioSaturateSaturationCasioSensitiveSensitivityNormalHigh+1.0+3.0+2.0UnknownLowSoftHardAutoTungstenDaylightFluorescentShadeManualWeakStrongOnOffRed Eye ReductionMacroInfinityEconomyFineSingle ShutterPanoramaNight ScenePortraitLandscapeProcessing Casio Maker Note (%d) QVCCasio maker note version not supported  0    @Pd}   |  -  - +qcasio_propcasio_ifdpLpunsigned int X L(  *P6PB P8] i p  |0t $(T8casio.c.LLC61.LLC62.LLC63casio_focuscasio_tags0casio_tags1casio_intensecasio_whitebcasio_rangeonce.0casio_sharpcasio_recordcasio_qualcasio_flashcasio_sensitivereadifddebugcasio_propmemcmpprintfcasio_ifdfinddescrdumppropexifwarn_GLOBAL_OFFSET_TABLE_  |<p<pp 'OxHu    <LTTp| %-5=EMU]eow$(,0488@L``hp !)19AIQYa i&&$ ( ,   $ D#LP lp x!&&   % ( 80P4`DxHX\`lpt(8HXhx  $(48<HxLX`h p(x08@H @PX@`hx@ @(`08@H@PX``hp@x@(8H@04  as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ ck% p1 7(?OH\/l {30c ppph \ P  X8 $0 $   $  &$?exif.o/ 1162995852 0 0 100644 28016 ` ELFj(4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I!I/ I.? : ;' @ : ;I 4: ;I .? : ;' I@ : ;I 4: ;I 4: ;I11 U41 11  U41.: ; ' : ; I!: ; I"4: ; I#4: ; I$.: ;' I %: ;I&: ;I'.: ;' (4: ;I)!*4: ; I? < GNU C 3.4.5exif.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintiunsigned charlong long intsize_tRzlong intlong unsigned intdoublefloatcharlong doubleint16_t<short intint32_t=\short unsigned intlong long unsigned intu_int16_t80u_int32_t9zorder LITTLE BIG exifprop, tag`# type`# countq# valueq# name# descr# str# lvl0# ifdseq\# ifdtag`# override`#" subtag#$ next#(  -exiftags props# tifforder# btiffc# etiffc# exifmaj# exifmin# mkrval# mkrinfo# \descrip> val?!# descr@# exiftagF tagG`# typeH`# countI`# lvlJ0# nameK# descrL# tableM#- fieldtype S typeT`# nameU# sizeV# ifield \ tag]i# type^i# count_y# value`y# yi i ifd f tagg`# numh`# fieldsi# nextj# 0makerfun4 val5\# name6# propfun7# ifdfun8;# ;0yexiffreentyh`exifscanynbchlen\i\jseq\kifdoffqtybcurifddtmpifdL'2=FRQlZHk|h`i]a'c1e=YGaRc]`kcvaPaXkreadtags dir seq\ ty!\"i\"tmporderreadtagL afieldJ ifdseqJ\ dirJ tJy!K\"iM\"jM\"propN#N$parsetag\%prop%dir%ty&\izlenzv`unqudqdenomqsn!sd!bufcd  exifparseynbchlen\ityacurpropi U    b Y  ( h     \ X postprop prop ty#"v`"valq"fval"o"h' (tweaklvli%proph%thycj(k 3i)*__ctypeX (*errno(\*debug\ m)*ftypes b \)*tags } -)*ucomment  -)*flashes  -)*filesrcs  )*makers:   /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.hmath_iso.hiso/math_c99.hmath.hieeefp.hfloatingpoint.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hexif.hexifint.hmakers.hexif.cctype_iso.herrno.h!"r"  "r{u hz{ld{  t$4`4`4||||~||X}};$p~X^Md[~ '   ~~{=W4r{u[FNmFN,[@ SL|||u %o2H3fMWaL ju7Z㿐 2 0`` `(&@` @@`/@  `$ $$$$$ @  ޶  aM@aI@$$ @* 2  *@ @ '$b|@'  @ "" *?0`c@ ` ` @  "` @ ``@  `Y   @@@6@@ 6` @`` `?``? &` (Q  @&``` &`6`  @  @" @  ` , @ `&` ``  &`6` '`I* @` `@  @ $b|@"T @  @̀ d'@* 2 &`@  `$T`"X$W`u`@@s  +$$0`|@ &@+`@ ``@  @@ `@` @ (`@ `` `@`@` @ `` @ @@@  ` $@@ @4btci@" "aL`*0``"`*0`` `?` `?  *`+``  @ }*0`` `?``? "`( ` @ @ @8*`2`(/$`(`2)#`(`@@@͐ @@ OЀ`/ Б* @: ,@`L@` @`@  @  @  `4*`2`@`&`$@ "4_(b|@2y`"   2`T+`@ ` `"`@$` "_`@2@ ` #@ @@ W*@  &``@ @```w+@`%@2?`   2*!0`#i@"`@$` 2@(@`@$`@ ` @߂#@2`` `@  &`  &@  ` +`(`/@4/@* `4:` @T`` `@ @ @ @ @ @ 2``"`@͔ ``  `@  `````, `2``  @ @:``@ `J?` `  ?"J?@ `2?"@  &`@`(@`K@ @?``6``@@@0@ &```E`@@`@ : <@@"@"@  @@`` 0+@+``p(``@ `<` I f(@(` n i t e(`(`(`(`(`(`(``U(``@@`@ @  `@@`"`"`<`< @ #@ @ ̀`@ ̀`'``@H'`@H ʂ`? `@ `(``@ X&`*``= 1 '@``%@@` @@ė*  @:`@``@``%@@`@ @* 2@`@@``@(`@ `<` @ #@ @ :`+@  ``''`  @ /``@ `(`''  r ʒ@``@ `t(`@`@``h(``X?˂`@0`$/'`,-`@H' ./`@H` @ ``@H./`@p/@   @`W` ' n` $b|@W`$@b@ { @ ]b  ❀@ "`4uba&,`"a#⚂(`0``!((b@ "`"``@@``@ @``@ `(``"``"```"`*0```(`R$` b|@@`T``(` @ ``"$@`"@ "+`4x)b@ "`&`b @2`"T``4`T`````@ `&`@ "i`b@2`"``@@``'@'@`'쑠(?@Ѐ  `@(?`@@@H?@@`'`@ `(`@` 8w`"`@ , s,  c e, , ,  @b@2d`"?b`6`"`@ "&`=`?ׂa@`8T`",`@'   ``Ȑ' @'  䑢I(?@Ѐ &`@@?` `@ `(`@2`"@  c&`` @`` (``@(?Ѐ@2`"0@@  `( `  `2 V` 6``"`` ! K`` `   K` @ `2   K`2` 6```@@?"q`@` 8`"`@ , E V, , , `@'  ``Ȑ'ܐ @'  ܑI(?@Ѐ  `@(?```@' w ``Ȑ' @' d 葢I(?@Ѐ " `@(?Ղ`` @ 2u`` U k(@(` o w(`(`(`(`(`C(``@J`@J`@@ @ U`(@ u s(`(` e d(`(`(`(` !6``@@?2`` I f(@(` i t y(`(`(`(`(`(` (``@J`@J`@bJ`@OJ``@@`` @2`" 6```@' 1 ``Ȑ' @'  I(?@Ѐ " `@(?1``@@@`"`@J`@͑JExifinvalid TIFF headerinvalid Exif format (couldn't read IFD0)Processing %s directory, %d entries unknown TIFF field typeProcessing directory %d, %d entries field type mismatchfield count mismatchmaker note not supportedinvalid Exif format (IFD length mismatch)%d.%d%.1f%d, %d/%d%dA?%d dp%s1/%df/%.1f%d mm%.2f mm%.2f m@?A?-  | d -  -   - 6 AexiffreeexifscanexifparseDTX0`X\\X(dT,p|dt|dtunsigned inttmppropdomkrX@`$h+P2H9p@tGxNU\cjqx    Px8"*2:CHRY`fmvld !* 4exif.c.LLC10.LLC11.LLC12.LLC13.LLC14.LLC15.LLC16.LLC17.LLC18.LLC19.LLC20.LLC21.LLC22.LLC23.LLC24.LLC25.LLC26.LLC27.LLC28.LLC29.LLC0.LLC1.LLC2.LLC3.LLC4.LLC5.LLC6.LLC7.LLC8.LLC9flashesreadifdstrlenpowputcharexif2sbyteexif2bytedebug.divftypesstrncpystrncmpnewprop__ctypeucommenttagsexif4bytememcmpprintf.udivmakersreadifdsfinddescrexifscanmallocgcdexif4sbyteexiffreeerrnodumppropisnansprintftolowerfloorfreeexifwarn2filesrcsexifwarnfindpropatoistrerror_GLOBAL_OFFSET_TABLE_snprintfexifparseexifdie (%%{T%X%dk %l%%D!%>W%[%\{8%%`G %% %p %| ( Z%| ^% m   % %%%"%*%$2%,:%DB%LJ%lR%|Z%b%j%t%|%%%%%%%%%%%%%%%%%% %,%4%8&%8.%@6%DA%TI%XQ%\Y%`a%di%lq%y%%%%%%%%%%%(%8%H%T%t%t%%%%%&%.%6%>%F%N% V%^%f%,n%4v%4~%L%\%p%%%%%%%%%%%%%  % %%$%0/%47%<?%DG%LQ%X\%hd%hl%pt%|%%%%%%%%%%%%%(%,%@%H%H%d%p%p%x'%/%:%B%J%R%\% d% n%(v%H%H%X%X%|%|%%%%%%%%%%%%!%)%1%49%XA%tI%tQ%|Y%a%l%t%%%%%%%%%%%(%(%0%@%L%T %\%d%|$%|.%6%>%F%Q%Y%a%i%q% y% % % % % ,% ,% 4% H% d% x% % % % % % % % % % !% )% 1% H 9% p A% | I% | Q% Y% a% i% q% y% % 0 % 8 % X % % % % % % % %  % ( % 0 % 0 % 8 % L % d % l % p % #% .% 6% D >% X F% t N% V% ^% f% n% v%T ~% % % % % % %( %8 % % % % % % % % %$ % % %( $%< ,%< 4%D <%H D%L L%L T%p _% g% o% w% % % % % % % %P %X %\ %p %| % % % % % % % % % '% /% 7% B%4 J%4 U%< ]%< g%T o%\ w%\ %l %l %t %x % % % % % % % %8 % % % % % % % % )%4 1%< 9% A% I% Q% Y% c% k%( s%@ {%L %d %t % % % % % % % % % % %% %%%$%,%4%<%D%L%T%\%d%$l%$t%<|%@%@%P%P%X%d%|%|%%%%,%@%@%`%h%x %%%#%+%3%4;%4C%<K%tU%]%e%m%u%}%%%%%X%%%%%%l%%%%%%,LDLLLpSxS|B ;0$:,?<l1p1  9 9  <6,0<0L::9 9  33 (9L P TV11 L0.11  0 4O<El9 9 !! M9 "" MG 9 9  FF RV4J4>8> X,h5@ > > ,TLB4 ? 0# 4# 8O dN hN xB Q Q $ $ T 9    9 $ 8 8 8 ; 8 8 8, `7 d7 B 4 F F R V B @D \D |C 2 2 + L: h: xC = =  48< LT pTB ,/ T8,d0T, O  @DH \T2 T2 I   = 0PT     = S$S0AT7X7 `d P :<:H=P T hT>> x*|* @DD H $ 8< H-`Kl p T,,D:x:H  - TB(, 8TL tP77 p:,,::4HDH L `d ::H   (:tx  ::X\ pt   :::D:tH   FF RV  &%0&4%lL&P%%as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 9 D %L1\7;h?=8dL=:\= k=y>>p *DT<F  H4  \ \  i|H  i  i  i?exifutil.o/ 1162995852 0 0 100644 12612 ` ELF.$4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.debug_frame.debug_pubnames.debug_aranges.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ > : ; I$ >  I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I .? : ; ' I@ 4: ; I .? : ;' @ : ;I 4: ;I.? : ;' I@ 4: ;I 4: ; I? < 4: ; I?  !GNU C 3.4.5exifutil.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlong intsize_t?long long intunsigned charcharint16_t <short intint32_t =`short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9orderLITTLEBIGcexifprop, tagD# typeD# countU# valueU# namec# descrc# str/# lvl# ifdseq`# ifdtagD# overrideD#" subtag#$ nextn#(i exiftags propsn# tifforderf# btiff# etiff# exifmaj# exifmin# mkrval# mkrinfo#@descrip> val?# descr@c#fieldtype S typeTD# nameUc# sizeVs#field \ tag]# type^# count_# value`#    ;ifd f taggD# numhD# fieldsi;# nextjA# pexifdie>^msg=cX exifwarnG^msgFcX exifwarn2O^msg1NcXmsg2NcY exif2byte[D^bZXoZfYEexif2sbytei^bhXohfY}exif4bytewU^bvXovfYexif4sbyte^bXofY finddescr/ntable@[valDii`\c/hFfindpropn^propnXtagDYfindspropn^propnXtagDYsubtagZnewpropnnpropnhchildpropnnparentnhpropnX Ahexprintnbhlen`ii``dumppropnpropnhafield;ii`readifd(Unb'hdir'it'jifdsize)UQAtRreadifdsbAnoffsetaUQtaifirstifdcAlcurifdcA`gcdyUnaxUhbxUierrno(`debug5`progname6c Fftypes /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hexifutil.cerrno.hQ  ( t*#r$ 'r(k)s!lu<`" (` (` @`" (` (` @ (`8``"  + (` @ +`@  + (` @ +`@ @ `"  + (` @ +`@  + (` @ +`@ @ 㿐/   .`0`+ @ @`@  2 ``@@@`@ *`0`@  ( @ 2 ( *`0`@ *8` ( @ 2 (R $@ 2 (08`R $@*㿐/@ , `@@@& $?6 $&& & & & & & & & & (㿐@ (" ( "     ?& (2" 2 " 2 2 $2 㿐 /l #`@ &㿈/Z`@ L`   @"V $ ` V $)`"2  ``   @`@ @`@ @`@ @`@`@ @   #\`  @ 0#\ `㿐  /@ .&@@`  &@@ `@@@4  @ @ (`@ ?   3 # @@ &@@@@@ 㿈`@  ` @  㿐`@` %02X %s (0x%04X): %s, %d; %d | %s (%d): %s, %d; %d, 0x%04X %s (0x%04X): %s, %d; %d, 0x%04X |     , 4 \ \ -  H t| - \ - H - \ -  - \ - 0 - Gexifdiepexifwarnexifwarn2exif2byte exif2sbyteEexif4byte}exif4sbytefinddescr findpropFfindspropnewpropchildprophexprintAdumppropreadifdreadifdsRgcddebugprognameunsigned int  (0$`*808(tBIOWD4b,lry|x\\8tHX0\\\H-exifutil.c.LLC0.LLC1.LLC2.LLC3.LLC4.LLC5readifdfindspropstrlen.uremputcharexif2sbyteexif2bytedebugftypesnewpropexif4byteprintfreadifdsfinddescrmallochexprintgcdexif4sbytestrcpychildpropprognameerrnodumppropfreeexifwarn2exifwarnfindpropstrerror_GLOBAL_OFFSET_TABLE_exifdie   X \       D$ D( x\ x`   0 8  $ (] (a     t t T X     Xd Xh %        $ 4 D D H H P ` h x& x. |6 |> F N V ^ f n v ~ 8 < @ P X x x         ( ( 4   & . 6 > F N V ^ f n v $~ , 4 8 < @ D H L P T X \ ` d h t x |   ( 0 8 @ H P X ` h p x    ( ( 0 0 8 ` p |           $" 0* 42 4: <B DL LT T\ Xd Xl `t h| x |                  $ ,  4  < (D @L XT \\ `d `l ht t| x x D-L-&& ,.#--&& ,.|-- --  <D X`d ht |         $-,-DL&P& p(,. 4h  $ ( 4 8 D H T X Dd h xt x   8    (      t  0 4 L P h l X as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 +_% g17? L\ k v ~5  !\  )@  ,(  -  -  -?fuji.o/ 1162995852 0 0 100644 10252 ` ELF$L4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I 4: ; I4: ; I  U.? : ; ' I@ 4: ; I? < (GNU C 3.4.5fuji.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintiunsigned charlong long intlong intcharint16_t <short intint32_t =\short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9zrorderLITTLEBIGQexifprop, tag2# type2# countC# valueC# nameQ# descrQ# str# lvl# ifdseq\# ifdtag2# override2#" subtag#$ next\#(W rexiftags props\# tifforderT# btiffc# etiffc# exifmaj# exifmin# mkrval# mkrinfo#.descrip> val?# descr@Q#exiftagF tagG2# typeH2# countI2# lvlJ# nameKQ# descrLQ# tableM#field \ tag]# type^# count_ # value` #  i  i difd f tagg2# numh2# fieldsid# nextjj# fuji_propnprop\htii\v2Yonce\bUfuji_ifdjnoffsetChtimyifdjTfujitbXfujilen\fujioff\Qerrno(\debug\  fuji_sharp2s  fuji_white>  fuji_colorM  fuji_flmodeW $ fuji_boolb K fuji_focusk; s fuji_picturetc  fuji_blurw  fuji_focusw  fuji_aew . fuji_tags7 /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hfuji.cerrno.h o%r  l(  㿐/`?c   `& `` `&  6 `@ " ``@ `% *`@2`& @  &   @   (@ `@ $`@@@ p``/`@` `'' ''''@    @* `0`ؐ@ԁFujiVersionMaker Note VersionFujiQualityQuality SettingFujiSharpnessSharpnessFujiWhiteBalWhite BalanceFujiColorChroma SaturationFujiToneContrastFujiFlashModeFlash ModeFujiFlashStrengthFlash StrengthFujiMacroMacro ModeFujiFocusModeFocus ModeFujiSlowSyncSlow Synchro ModeFujiPicModePicture ModeFujiBracketContinuous/Bracketing ModeFujiBlurWarnBlur StatusFujiFocusWarnFocus StatusFujiAEWarnAuto Exposure StatusFujiUnknownFuji UnknownOKOver ExposedUnknownOut of FocusBlur WarningAutoPortraitLandscapeSports SceneNight SceneProgram AEAperture Prior AEShutter Prior AEManual ExposureManualOffOnRed Eye ReductionNormalHighLowDaylightCloudyDaylight Color FluorescenceDaywhite Color FluorescenceWhite FluorescenceIncandescenceCustomSoftHardProcessing Fuji Maker NoteFUJIFILM  !01 | h -  - ),pfuji_propfuji_ifd ,Dunsigned int( 0 "T +l7TAPNdH YD d k0v hpfuji.cfuji_flmode.LLC64.LLC65fuji_aewfuji_focuswfuji_tagsfuji_picturefuji_whitefuji_coloronce.0fuji_sharpfuji_focusfuji_blurwfuji_boolreadifdexif2bytedebugputsfuji_propstrncpystrncmpfinddescrmallocfuji_ifderrnodumppropstrerror_GLOBAL_OFFSET_TABLE_exifdie   {pp 7_  ' ,<DD`lptx|&.6>FNV`h px,8D`pt| $,4 ))   '#$!, 0D&H& P(X*|)) "  ( 80H4X8DhHxLX\`lpt(8HXh   $( 48 <H8LHXX``hppXxxpXp p0p8@p (@088H@pH`PhXp`phpxxp`p04p  as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ ce,% ;1  79?,OH\P-l} { t X 8 8 #0 #   #  &$ ?jpeg.o/ 1162995852 0 0 100644 9444 ` ELF!$4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% : ; I : ;  : ; I8  : ; I 8 $ >  I$ > &I .: ; ' I@ 4: ; I 4: ; I .? : ; ' I@ : ; I 1141  11 U.: ; ' I .: ; ' : ; I.? : ;' I@ : ;I I!I/ GNU C 3.4.5jpeg.c/home/falko/e/e17/libs/epsilon/src/lib/exiftags__FILEj)__FILE_cnt#)#_ptr$0#_base&0#_flag'6# _file(6# __orientation)G# __ionolock*G# __seekable+G# __filler,G# int6unsigned charlong long intFILEJ\long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong double ~"jpgprocessBsofC)#strD# Kjpg1byte\)n b]) jpg2bytenGn b1oGa b2oGX mkrlenGn lGX ajpegscan)nfpahmarkgilenmjfirst)ks9kkh`_)Gtopmkr)skipmkr lGsofmrkmark) i) lGAjpeginfo4)nprcsn2ghcmpnts2giheight2mjwidth2mkprcss3l infile3a jpg_prcsn7) jpg_cmpnts8) jpg_height9G jpg_width:G jpg_prcss; seensof=)w processE? /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hjpeg.co#~@uuxIGU_㿐/`@@㿐/`@@8`?8`? ?,`@㿐/خ` ?@?㿐/Ǯ`#@#  ?@`"&@`%+` @  Qj  0 [& `#@`#@`#@` @     @ ` .  `@` @  `@  `@"`@0Y 2 #  M KI` #XXXXXXXXXXXXXPPXXXXXX㿐/`;&``&@;&``&@BaselineExtended sequentialProgressiveLosslessDifferential sequentialDifferential progressiveDifferential losslessExtended sequential, arithmetic codingProgressive, arithmetic codingLossless, arithmetic codingDifferential sequential, arithmetic codingDifferential progressive, arithmetic codingDifferential lossless, arithmetic codingUnknowninvalid JPEG marker (length mismatch)invalid JPEG SOF marker (length mismatch) | , - d - @ -  - x - (jpegscanjpeginfounsigned int  p  )  1  <@C M, V ` j4ds zxjpeg.c.LLC14.LLC15processjpg_cmpntsseensofjpg_heightmkrlenjpg_widthjpg1bytejpg_prcssjpg_prcsnjpg2byteinfilefgetcjpegscanjpeginfo_GLOBAL_OFFSET_TABLE_exifdie    Hx7 ; 4` 4d      T p p ( p, > B L  Qh L V  ^ f n 4v 8~ < H \ d                 & . 8 @ ,J TT h\ pg xo w                  ( 0 0 8 H! H) P1 X9 \A `I hQ lY ta xi q y                     # + 3 ; C K S [ c k s  {    $8<DH P\  <$     4 P X dp            (8$H,`4<DLT\0d`l 04 4LP hl     as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ c%1 t7?|pO\,l {  8    Hx       & ?makers.o/ 1162995852 0 0 100644 3220 ` ELF 4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.debug_pubnames.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.data.rel.rela.debug_pubnames.comment% $ > $ > : ; I I&I : ;  : ; I8 I !I/   I4: ; I?  yGNU C 3.4.5makers.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlong intlong long intunsigned charcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t 8!rfield \tag ]r#type ^r#count _#value `#    ifd ftag g #num h #fields i#next j#&9makerfun4val5^#name6#propfun7@#ifdfun8Q# @ 9 Q F g makers-WH8 /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/sys/usr/include/usr/include/sysiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hmakers.cunknowncanonolympusfujifilmnikoncasiominolta}gmakersunsigned int   -8COY`js|makers.cminolta_ifdfuji_propolympus_propcanon_propcasio_propolympus_ifdnikon_ifdmakerscasio_ifdreadifdsfuji_ifdminolta_propnikon_prop rxE   $ ( ,4 8 <D (HLT 0X\d 8hl t as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 }%L1]7`@?I Y= dLp ltPT         ?minolta.o/ 1162995852 0 0 100644 27436 ` ELFgl4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ;' @ : ;I 4: ;I 4: ;I U.? : ;' I@ 4: ; I? < 4: ; I GNU C 3.4.5minolta.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlunsigned charlong long intlong intlong unsigned intdoublefloatcharlong doubleint16_t<short intint32_t=_short unsigned intlong long unsigned intu_int16_t8u_int32_t9}orderLITTLEBIGgexifprop, tagH# typeH# countY# valueY# nameg# descrg# str# lvl# ifdseq_# ifdtagH# overrideH#" subtag#$ nextr#(m exiftags propsr# tifforderj# btifff# etifff# exifmaj# exifmin# mkrval# mkrinfo#Ddescrip> val? # descr@g#exiftagF tagGH# typeHH# countIH# lvlJ# nameKg# descrLg# tableM#field \ tag]# type^# count_!# value`!# !l  1l zifd f taggH# numhH# fieldsiz# nextj#1 cminolta_cpropnproprhoffitcjthetagsiki}bj}Qk}`vYmodel ed !cpf_valbuffcapropraxD minolta_navalnpropsrhtagHisubtagjproprjnag aminolta_propnproprjtcii_fielddefsi[tmpproprXonce_minolta_ifd+noffset*Yht*caerrno(_debug_  minolta_brackmode8  minolta_brackstepC / minolta_sharpM Z minolta_colorWJ  minolta_isocu  minolta_boolo  minolta_focusmodex  minolta_focusarea 6 minolta_widefocus& e minolta_driveU  minolta_whitebal  minolta_flash  minolta_scene  minolta_quality  A minolta_prog 1 k minolta_size [  minolta_folder   minolta_imprint   minolta_model   minolta_metermode  JD minolta_tags : uD ,minolta_0TLM1 e D minolta_unkn   /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.hmath_iso.hiso/math_c99.hmath.hieeefp.hfloatingpoint.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hexif.hexifint.hmakers.hminolta.cerrno.huX ~ 0~t%~Ie1i+]7CQc-E":*h\(u[%rgg  4`?      EU0^?U[as 㿈  /   )  `?2  @ `?3@, 4`$@?c$`@   @  ``@ (``(``$` `` `$` 4`@    ,@  @à*`@2`$`@   2 + )8 `%,  @ ?逤` ?`4`"`$`$`!  N o**  r m* *  a l* * * ``$``J '쀠`9``  ʂ`?@  ?`4`"$``'쀠` `@H``$``ڦ  I f**  n i t e* * * * * * * `@ dl$`$``'쀠` `@H```W$`?` S4`"?bO4`"?`K4`"?`"G4`"` 0 @ 8` @ '  $``H ?@``7` `@ 7ȁ@'``'$``'쀠` `` H@?@ `@ H@'*``2@  $```  ` @  $``'쀠` [``H @?@ ``)?$`` +`  @ ` Ӓ @  ,`@@@,`'쀠`?`@ (?`@ #`H' k`@H`@H`@fH`@ŕH`@ H`@ g `@HpLp F T$P e(r |( 0(d(  (, 040>0N8\fmq{ \xhp ( D5>T]minolta.cminolta_boolminolta_flashminolta_driveminolta_metermodeminolta_quality.LLC120.LLC181.LLC182.LLC183.LLC184.LLC185.LLC186.LLC187.LLC188.LLC189.LLC190.LLC191.LLC192.LLC193.LLC194.LLC195.LLC196.LLC197.LLC198.LLC199.LLC200.LLC201.LLC202.LLC203.LLC204.LLC205.LLC206.LLC207.LLC208.LLC209minolta_sharpminolta_whitebalminolta_sizeminolta_focusmodeonce.0minolta_modelminolta_focusareaminolta_isominolta_0TLMminolta_brackmodeminolta_tagsminolta_folderminolta_progminolta_unknminolta_widefocusminolta_brackstepminolta_colorminolta_imprintminolta_scenefindspropstrlenpowexif2bytedebugputsminolta_ifdminolta_cpropstrncpyminolta_navalexif4byte.udivreadifdsfinddescrmallocstrcmpstrcpychildproperrnodumppropfreeexifwarn2exifwarnfindpropminolta_propstrerror_GLOBAL_OFFSET_TABLE_snprintfexifdie) 4. .~..p.p. . . \H[1{. \. 9@F(qA70"6Q>|+ C - W< - ; B 2 6 a: 8 =.. ...  .$(.(0.48.\@.\H.hP.hX.p`.|h.p.x......... ....$.0.0.<.H.H .P.\.d%.d-.l5.t=.E.M.U.].e.m.u.}.. . ..L.T.X.\.`.d.d.l..... ...%.(-.,5.0=.4E.8M.8U.@].|e.p.x........... ...$.\.`.| ...#.-.5.=.E.HM.LU.P].`e.pm.tu.x}.|........... .$.<.@.T.` .`.h.p#.+.3.>.F.N.X.b.,j.Dt.\~.t...p.t.x............. .  . (. 0. ,8. 0@. 0H. XP. `X. ``. |h. p. x. . . . . . . . . . . . . . . . . . ( . 8. 8. @". H*. H2. P:. \B. lJ. R. Z. b. j. r. z. . . . . . . . . . . . . . . . ,. , . 4 . < . < . D ". \ *. l 2. | :. D. L. T. \. d. n. v. ~. . .  .  .  . $ . < . L . T . X . \ . . . . . . . .  . $.  ,. ( 4. 0 ?. L G. \ O. ` W. h _. t g. o. w. . . . . . . . . . . ^^0848 pUNW$8 L8 \XxQW8 ^^      _  $ O  @H X` tF     F(, HP `_p| _  F $( TRdVpV x]`   _  , 0 D H \ ` t x   _  t x^^ DXERVV T] ` ^ (^ 8: <: H H 1 1 ! W ,D TM dM tD D M M M [ D HD tM M & 8 8 K ! I & Z = = (R DL T# \# dS x$ |$ S % % Y M M M M M M M 0V 4V <] D` d' h^ p^ t' S % % G % % P Z5 5<5( 5@$05P45`8+D5pH5L-X5\5`l5p5t55555(585H5X5h5x5555 55@ 5$545850H5@L5P\5``5xp5t5x55555555 585H5X5h5x555($5(5,C85<5L5P5(T7`5@d5Ph2t5`x5x|55;55A55555 505@5P5`5p55>(5,500<5@5D6P5T5X9d5h5(lBx58|5H5`5h5x555555h5555555555 5(50585 @50H5@P5PX5``5h5pp5x555555555555 5555555   5((5050858@5@H5P5HX5P`5h5Xp5hx5555555555555 5p5 5 55 (5 85 H5 X 5(505 `85 p@5 xH5 P5 X5 `5 h5 p5x5 5 5 5 55 5 5 855585H5 P5 h5 5 5  5 5  5 05 45 D5 8H5 HX5 h\5 xl5p5 /.0/4.pL/P. h/l. \**.as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ ct % 0 1 7% ?2xO:T\:Wl;+ {;K;c ;p;pDAeD F  S [  f` g   g  &g,?nikon.o/ 1162995852 0 0 100644 11356 ` ELF(4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ;' @ : ;I 11 U4141 4: ;I .: ; ' : ; I4: ; I.? : ;' I@ 4: ; I? < 4: ; I yGNU C 3.4.5nikon.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintjunsigned charlong long intlong intcharint16_t <short intint32_t =]short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9{sorderLITTLEBIGRexifprop, tag3# type3# countD# valueD# nameR# descrR# str# lvl# ifdseq]# ifdtag3# override3#" subtag#$ next]#(X sexiftags props]# tifforderU# btiffd# etiffd# exifmaj# exifmin# mkrval# mkrinfo#/descrip> val?# descr@R#exiftagF tagG3# typeH3# countI3# lvlJ# nameKR# descrLR# tableM#field \ tag]# type^# count_ # value` #  j  j eifd f tagg3# numh3# fieldsie# nextjk# 6nikon_propnprop]ht6i<Q]fo`xXY`Xonce]cnikon_prop1prop]t6i]aDbDv3nikon_prop0prop]t6i]aDbD"nikon_ifd$knoffset#Dht#6imyifd%kldebug] A nikon_quality21 l nikon_color?\  nikon_adjustH  nikon_ccdT  nikon_white_  nikon_convertm :/ nikon_tags0v* c/ nikon_tags1S  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hnikon.c U8\^R&nkR>sq 㿈V`/`Q`?c   `& `` `&  c6 ` Q` @@``  @`  ''왠쀢 ʑ (`?  @ `@ )`?`c  @ "@`@ @`& + `3 ` &   6  ">``@ e`` @ *`@2`& `@V` $` @@` ` @`"`'쀤 6'왠쀢 *ʑ (` @@``  @`x` @  6 `@uH`@iH`@ԕH`@ȕH㿈`/@`@   6`@NikonQualityImage QualityNikonColorColor ModeNikonImgAdjustImage AdjustmentNikonCCDSensitiveCCD SensitivityNikonWhiteBalWhite BalanceNikonFocusFocusNikonDigiZoomDigital ZoomNikonAdapterLens AdapterUnknownNikon UnknownNoneFisheyeAutoPresetDaylightIncandescentFluorescentCloudySpeedlightISO 80ISO 160ISO 320ISO 100NormalBright(+)Bright(-)Contrast(+)Contrast(-)ColorMonochromeVGA BasicVGA NormalVGA FineSXGA BasicSXGA NormalSXGA FineNikonISOSetISO SettingNikonSharpImage SharpeningNikonFocusModeFocus ModeNikonFlashSetFlash SettingNikonISOSelectISO SelectionNikonFocusDistFocus Distancex%.1fProcessing Nikon Maker Note (%d) N/Ax%.1f mANikon   |  - l - +}qnikon_propnikon_ifd<0@L0Lunsigned int  0p`%h ,83x :F Rd ^l (v@  |840lnikon.c.LLC18.LLC56.LLC57.LLC58.LLC59.LLC60.LLC61nikon_tags0nikon_tags1nikon_colornikon_convertnikon_ccdnikon_whiteonce.0nikon_qualitynikon_adjustreadifddebugexif4byteprintfnikon_ifdfinddescrstrcmpdumppropnikon_prop_GLOBAL_OFFSET_TABLE_snprintf |  <@80X&O x   <LTTp| !)19CKS[emu@}\   "*40<@DLOdW|_gow(X ''$ ( ,    8(@D X` h   % #0 8!X t |     ((, @D X\ pt  '' $  0$0@4P8DhHLX\`lp(08@P`px (08@HPX`hpx(8HXhx 0  $48HL\@`Ppt 04as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ cS}% 31D7@~?OxH\/l {P_ ll8 H !X $0 (0 (8   (D  &(\?olympus.o/ 1162995852 0 0 100644 9692 ` ELF"4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.local.debug_frame.debug_pubnames.debug_aranges.debug_ranges.debug_str.bss.symtab.strtab.rela.debug_info.rela.debug_line.rela.text.rela.data.rel.local.rela.debug_frame.rela.debug_pubnames.rela.debug_aranges.comment% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I 4: ; I4: ; I  U.? : ; ' I@ 4: ; I? < GNU C 3.4.5olympus.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlunsigned charlong long intlong intcharint16_t <short intint32_t =_short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9}uorderLITTLEBIGTexifprop, tag5# type5# countF# valueF# nameT# descrT# str # lvl# ifdseq_# ifdtag5# override5#" subtag#$ next_#(Z uexiftags props_# tifforderW# btifff# etifff# exifmaj# exifmin# mkrval# mkrinfo#1descrip> val?# descr@T#exiftagF tagG5# typeH5# countI5# lvlJ# nameKT# descrLT# tableM#field \ tag]# type^# count_# value`# l  l gifd f tagg5# numh5# fieldsig# nextjm# olympus_prop`nprop__ht_iia_abF`bbFXvc5Yoffsetd `aprope_boncez_ecolympus_ifdmnoffsetFhtimyifdmlerrno(_debug_  olympus_macro4  olympus_quality= 1 olympus_tagsG /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.holympus.cerrno.hs t   ?I %(t ) 㿈V $/ `?c  `& `` `&  K6 `@ " ``7@ b"; b`0h` @@``  @`q 's'왠쀢 |ʑ ( ?`  @ `@ $*`@2`& `@`@`` $ $ $4@`@ `` $$ $4@ @``` 4$$ 6$@ "&  # c@c@` @  (`` @ `@H`@@@ `@H㿈`/@`@  @OlympusShootModeShooting ModeOlympusQualityCompression SettingOlympusMacroModeMacro ModeOlympusDigiZoomDigital ZoomFirmwareVerFirmware VersionOlympusPicInfoPicture InfoOlympusCameraIDCamera IDUnknownOlympus UnknownNormalMacroSQHQSHQProcessing Olympus Maker Notex%.1fOlympusPicModePicture ModeOlympusSeqNumSequence NumberOlympusPanDirPanoramic Direction%03d-%04dNoneAOLYMP4  | l - ` - /solympus_propolympus_ifdunsigned int @hx '.5<C`JQX  _ l  |  lt` #,olympus.c.LLC21.LLC22.LLC23.LLC24.LLC25.LLC26.LLC27.LLC28.LLC29.LLC30.LLC31.LLC32olympus_tagsolympus_qualityonce.0olympus_macroreadifd.uremdebugputsolympus_propexif4byteolympus_ifd.udivfinddescrmallocstrcmpchildproperrnodumppropstrerror_GLOBAL_OFFSET_TABLE_snprintfexifdie ~t-t1   HPPlx| #+3;CKS[cks{ 8<<D % -5=E$M0U4]8e<m@uD}HLPTXdptx| '0/L7T?tGxOW_gow--(,   +#0#|  . !&)#  )(#048 < X)h#ptx | '%  .  .  0*4* <,D/T X | -- ( ( 8$0P4h8DxHX\lp (0804tas: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54/ ce%i1 7?OH\3l {;S ```4 HP   \, !0 !   !  &!?tagdefs.o/ 1162995852 0 0 100644 18780 ` ELFFd4(.shstrtab.debug_abbrev.debug_info.debug_line.text.rodata.data.rel.data.rel.local.debug_pubnames.debug_str.symtab.strtab.rela.debug_info.rela.debug_line.rela.data.rel.rela.data.rel.local.rela.debug_pubnames.comment% : ; I$ > $ >  I&I : ;  : ; I8 I !I/ 4: ; I?  4: ;I?  rGNU C 3.4.5tagdefs.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagssize_t-mlong intunsigned charcharshort intint32_t=intlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t 8?sdescrip >val ?#descr @9#exiftag Ftag G(#type H(#count I(#lvl J#name K9#descr L9# table M#D4fieldtype Stype T(#name U9#size V_# D t ftypes 44 is tb tags Y D t ucomment I} D t flashes  D t filesrcs  D t compresss Y *D t pixelcomps b SD t orients kC yD t planarconfigs zi D t resunits  D t chromratios  D t chrompos  D t expprogs   DD t compconfig 4 mD t metermodes ] D t lightsrcs  D t colorspcs  D t imgsensors  D t scenetypes & ;D t customrend .+ eD t expmode 7U D t whitebal A| D t scenecaptypes J D t gainctrl U  D t processrange a 5D t saturate k% ]D t subjdist uM  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/sys/usr/include/usr/include/sysiso/string_iso.hmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.htagdefs.cImageWidthImage WidthImageLengthImage HeightBitsPerSampleNumber of Bits Per ComponentCompressionCompression SchemePhotometricInterpretationPixel CompositionFillOrderDocumentNameImageDescriptionTitleMakeEquipment MakeModelCamera ModelStripOffsetsImage Data LocationOrientationImage OrientationSamplesPerPixelNumber of ComponentsRowsPerStripNumber of Rows Per StripStripByteCountsBytes per Compressed StripXResolutionHorizontal ResolutionYResolutionVertical ResolutionPlanarConfigurationImage Data ArrangementResolutionUnitResolution UnitTransferFunctionTransfer FunctionSoftwareCamera SoftwareDateTimeImage CreatedArtistPhotographerWhitePointWhite Point ChromaticityPrimaryChromaticitiesChromaticities of Primary ColorsTransferRangeJPEGProcJPEGInterchangeFormatOffset to JPEG SOIJPEGInterchangeFormatLengthBytes of JPEG DataYCbCrCoefficientsColor Space Xform Matrix Coeff'sYCbCrSubSamplingChrominance Comp Samp RatioYCbCrPositioningChrominance Comp PositioningReferenceBlackWhiteBlack and White Ref Point ValuesCFARepeatPatternDimCFAPatternBatteryLevelCopyrightExposureTimeExposure TimeFNumberF-NumberIPTC/NAAExifOffsetExif IFD PointerInterColorProfileExposureProgramExposure ProgramSpectralSensitivitySpectral SensitivityGPSInfoGPS Info IFD PointerISOSpeedRatingsISO Speed RatingOECFOpto-Electric Conversion FactorExifVersionExif VersionDateTimeOriginalImage GeneratedDateTimeDigitizedImage DigitizedComponentsConfigurationMeaning of Each CompCompressedBitsPerPixelImage Compression ModeShutterSpeedValueShutter SpeedApertureValueLens ApertureBrightnessValueBrightnessExposureBiasValueExposure BiasMaxApertureValueMaximum Lens ApertureSubjectDistanceSubject DistanceMeteringModeMetering ModeLightSourceLight SourceFlashFocalLengthFocal LengthSubjectAreaSubject AreaMakerNoteManufacturer NotesUserCommentCommentSubsecTimeDateTime Second FractionSubsecTimeOrginalDateTimeOriginal Second FractionSubsecTimeDigitizedDateTimeDigitized Second FractionFlashPixVersionSupported FlashPix VersionColorSpaceColor Space InformationPixelXDimensionPixelYDimensionRelatedSoundFileRelated Audio FileInteroperabilityOffsetInteroperability IFD PointerFlashEnergyFlash EnergySpatialFrequencyResponseSpatial Frequency ResponseFocalPlaneXResolutionFocal Plane Horiz ResolutionFocalPlaneYResolutionFocal Plane Vert ResolutionFocalPlaneResolutionUnitFocal Plane Res UnitSubjectLocationSubject LocationExposureIndexExposure IndexSensingMethodSensing MethodFileSourceFile SourceSceneTypeScene TypeColor Filter Array PatternCustomRenderedRenderingExposureModeExposure ModeWhiteBalanceWhite BalanceDigitalZoomRatioDigital Zoom RatioFocalLenIn35mmFilmFocal Length (35mm Equiv)SceneCaptureTypeScene Capture TypeGainControlGain ControlContrastSaturationSharpnessDeviceSettingDescrDevice SettingsSubjectDistRangeSubject Distance RangeImageUniqueIDUnique Image IDUnknownMacroClose ViewDistant ViewNormalLowHighSoftHardNoneLow Gain UpHigh Gain UpLow Gain DownHigh Gain DownStandardLandscapePortraitNight SceneAutoManualAuto BracketCustomDirectly PhotographedDSCNot DefinedOne-Chip Color AreaTwo-Chip Color AreaThree-Chip Color AreaColor Sequential AreaTrilinearColor Sequential LinearsRGBUncalibratedNo FlashFlash, Return Not DetectedFlash, Return DetectedFlash, CompulsoryFlash, Compulsory, Return Not DetectedFlash, Compulsory, Return DetectedNo Flash, CompulsoryNo Flash, AutoFlash, AutoFlash, Auto, Return Not DetectedFlash, Auto, Return DetectedNo Flash FunctionFlash, Red-Eye ReduceFlash, Red-Eye Reduce, Return Not DetectedFlash, Red-Eye Reduce, Return DetectedFlash, Compulsory, Red-Eye ReduceFlash, Compulsory, Red-Eye Reduce, Return Not DetectedFlash, Compulsory, Red-Eye Reduce, Return DetectedFlash, Auto, Red-Eye ReduceFlash, Auto, Red-Eye Reduce, Return Not DetectedFlash, Auto, Red-Eye Reduce, Return DetectedDaylightFluorescentTungstenFine WeatherCloudy WeatherShadeDaylight FluorescentDay White FluorescentCool White FluorescentWhite FluorescentStandard Light AStandard Light BStandard Light CD55D65D75D50ISO Studio TungstenOtherAverageCenter Weighted AverageSpotMulti SpotPatternPartialDoes Not ExistYCbCrRGBNormal ProgramAperture PriorityShutter PriorityCreativeActionPortrait ModeLandscape ModeCenteredCo-SitedYCbCr4:2:2YCbCr4:2:0icmChunky FormatPlanar FormatTop, Left-HandTop, Right-HandBottom, Right-HandBottom, Left-HandLeft-Hand, TopRight-Hand, TopRight-Hand, BottomLeft-Hand, BottomRGBYCbCrUncompressedJPEG Compression (Thumbnail)ASCIIJISUNICODEbyteasciishortlongrationalsbyteundefinedsshortslongsrationalfloatdoubleunknown  (-12;>?Vis"$%'(     |        !  AEGIMOY]_     vDftypesitagsucommentflashesfilesrcscompresss*pixelcompsSorientsyplanarconfigsresunitschromratioschromposexpprogsDcompconfigmmetermodeslightsrcscolorspcsimgsensorsscenetypes;customrendeexpmodewhitebalscenecaptypesgainctrl processrange5saturate]subjdistunsigned int   ! )4?FhQ`0Z8d(mpPvh  H(@ 0@(@  Htagdefs.cflashesplanarconfigsexpmodescenetypescustomrendftypespixelcompsgainctrllightsrcsucommentexpprogscolorspcstagssubjdistorientsscenecaptypeschromposprocessrangechromratioswhitebalcompconfigresunitsfilesrcsimgsensorscompressssaturatemetermodes nuUy !#?e   0Y%"'Qx !I$q    00 @4 PD pH L#X \ `l       ( 0 @ P h x     $ 4 8 (H @L P\ h` d p t x        ( 0 @ P p   $ ( 8 <  L 8P P` xd ht x |   ( @ P ` ` p    ( , < P T Xd  h 8x P| X p           0 H ` x  , 0 @ D T X h  l 8| P ` x %              (  8  @  P0  p4  D  H  X  \  l  p  0t  H   X 0  h                0  H  h    $  ( 4  8  H  L  \  `  0d"p  @t  P  `  p @                     0  H  h  $  (  ,8  <  @L  P  T$`  d  ht  x   ( @ P ` h p  `$ , 4 < `D L T \ `d l t |   `    0 ` @ H ` @ H P `  ` ` h ` $ `, 4 < D L T \ d `l  t (| ` 8  H h         H h      P $ , 4 `< `D L  T 0\ d @l Pt `| h           ( 0 H ` ` P X p x  $ H, `4 < D L T \ d l `t | H     ( 0 @ ` P ` ` p  `      `$ , 4 < D L (T 8\ Pd `l ht p| ` x  `             0$ 80 @< PH XT `as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.54 v%+!1 L7 Ph? I(t\Y-i/X t/h` |12  4l  4x  >h  F  F$?0707010000e3af000081ed0000000200000002000000014551e90900000843000000760000000700000000000000000000001800000000reloc/lib/libepsilon.la# libepsilon.la - a libtool library file # Generated by ltmain.sh - GNU libtool 1.5.22 (1.1220.2.365 2005/12/18 22:14:06) # # Please DO NOT delete this file! # It is necessary for linking the library. # The name that we can dlopen(3). dlname='libepsilon.so.0' # Names of this library. library_names='libepsilon.so.0.0.1 libepsilon.so.0 libepsilon.so' # The name of the static archive. old_library='libepsilon.a' # Libraries that this one depends upon. dependency_libs=' -R/opt/csw/lib -R/usr/sfw/lib -R/usr/openwin/lib -L/usr/local/lib /usr/local/lib/libImlib2.la -L/opt/csw/lib -L/usr/X11R6/lib /usr/local/lib/libepeg.la -L/usr/sfw/lib /usr/local/lib/libedje.la -L/home/falko/e/e17/libs/ecore/src/lib/ecore/.libs -L/home/falko/e/e17/libs/ecore/src/lib/ecore_txt/.libs -L/home/falko/e/e17/libs/ecore/src/lib/ecore_job/.libs -L/home/falko/e/e17/libs/ecore/src/lib/ecore_x/.libs -L/home/falko/e/e17/libs/ecore/src/lib/ecore_con/.libs -L/home/falko/e/e17/libs/ecore/src/lib/ecore_file/.libs -L/opt/build/michael/xrender-0.8.3-buildroot/opt/csw/lib -L/usr/openwin/lib /usr/local/lib/libecore_evas.la /usr/local/lib/libecore_x.la -lXrender /usr/local/lib/libecore_job.la /usr/local/lib/libecore_txt.la -liconv /usr/local/lib/libecore_config.la /usr/local/lib/libecore_ipc.la /usr/local/lib/libecore_desktop.la /usr/local/lib/libecore_file.la /usr/local/lib/libecore_dbus.la /usr/local/lib/libecore_con.la /usr/local/lib/libecore.la -lcurl /opt/csw/lib/libidn.la -lssl -lcrypto -ldl -lsocket -lnsl /usr/local/lib/libevas.la /opt/csw/lib/libfontconfig.la /opt/csw/lib/libfreetype.la /opt/csw/lib/libexpat.la -lXext /opt/csw/lib/libXrender.la -lX11 -lXp -lXrandr /opt/csw/lib/libiconv.la /usr/local/lib/libeet.la -ljpeg -lz /opt/csw/lib/libjpeg.la /usr/local/lib/libembryo.la -lm' # Version information for libepsilon. current=0 age=0 revision=1 # Is this an already installed library? installed=yes # Should we warn about portability when linking against -modules? shouldnotlink=no # Files to dlopen/dlpreopen dlopen='' dlpreopen='' # Directory that this library needs to be installed in: libdir='/usr/local/lib' 0707010000e3b0000081ed0000000200000002000000014551e9080002eb3c000000760000000700000000000000000000001e00000000reloc/lib/libepsilon.so.0.0.1ELF44 ($#FFFF78dPP  !#$%&')+-./012589:;<>@BDEFHIKLMPQRUVWXYZ[\]^_`adefgilnpqrtuvwxyz{} "(*,3467=?ACGJNOSTbchjkmos|~ $(D 1$ Hz8 _ houtXl xL < ~ "#(GN~( dkTl | q Dd qhz  Rqt&<z<T Lq@Wcjv vx  ~t   s@z qX& 3H <t(HNtpHV[l q\ P h  d\ \ | h ! A} RsP[uX afD o~lxur q F ">FQjp  \ Ԑ4 tL  d, %4C  W^e| mtd |tt  *?p(M csqx@~ pp th l xT &,F 3p @tl JQ[\  e \ p0RՄ ڤ0  H\ I (4 3~p F~h LT U,H ^ e x      "Uu< t@  w ! 0 G4 Z} a ~  lx t( v, L L         @ !\ , 5T` A IpP  R Y `s8Hepsilon_info_exif_props_as_int_getminolta_propepsilon_exif_info_freeepsilon_resolution_setexifscanfcloseimlib_context_set_imageftypesplanarconfigsolympus_propepsilon_plugin_loadMD5Initepeg_quality_setepsilon_mime_for_extension_gettolowerfseekpow__deregister_frame_infoexiffreeepeg_thumbnail_comments_enablefwriteepsilon_info_exif_getstrcpyepsilon_generategetenvcallocepsilon_message_newecore_str_comparesprintfstrncmpexpmodefilesrcsepsilon_file_getimlib_load_image_immediately_without_cachequietwhitebalcompresssecore_list_goto_firstepsilon_key_setcustomrendepeg_encodememcpyepsilon_newjpeginfoepsilon_ipc_client_send_endepsilon_ipc_pushecore_con_client_sendecore_con_server_sendfopencasio_ifdMD5Updatedlsymcompconfigepsilon_thumb_file_getscenetypes_lib_versionhexprintchromratios.uremorientsatoievas_object_showepsilon_info_exif_props_as_string_getcolorspcsdumpprop_DYNAMICminolta_navalfuji_prop_Jv_RegisterClasseschildpropexif4byteepsilon_info_freeminolta_cpropevas_object_resizeepsilon_exif_info_direction_getepsilon_info_getexpprogs_finiputsfuji_ifdprognamemakerslightsrcsepeg_decode_size_setfreadecore_dlist_currentMD5Finalerrnoecore_event_handler_addecore_evas_buffer_newflashesfprintfmalloc_GLOBAL_OFFSET_TABLE_epeg_thumbnail_comments_getreallocepeg_closeecore_con_server_connectmkdirepsilon_ipc_server_sendepsilon_existsstrcasecmpgethostnameexifwarn2exif2sbyteecore_dlist_nextchromposecore_hash_getepeg_file_output_set.udivexifdieepsilon_addexif2byteecore_str_hashecore_hash_setepsilon_ipc_consumeperrorstrdupnewpropstrlenreadifdecore_event_handler_delforkfindspropecore_list_nextecore_event_addecore_con_initecore_dlist_appendjpegscanexeclpecore_shutdownimlib_image_formatecore_dlist_removeedje_object_file_setscenecaptypesepsilon_exif_info_getedje_object_addimgsensorsnikon_propfgetcsaturatereaddirpixelcompsepsilon_shutdown__ctypeecore_evas_getedje_message_signal_processepsilon_delepsilon_initimlib_create_image_using_datafloor_etextprocessrangenikon_ifdusleepedje_initexifparseECORE_CON_EVENT_SERVER_ADDmemsetecore_list_destroyexif4sbytegainctrl.divmemmoveisnan__dso_handleECORE_CON_EVENT_SERVER_DELfinddescrgcd__iobstrrchrreadifds_PROCEDURE_LINKAGE_TABLE_casio_propEPSILON_EVENT_DONEdebugexifwarnfindpropstrcmpecore_con_shutdownepsilon_thumb_initepeg_file_openepsilon_info_exif_props_printecore_hash_newepeg_size_getecore_init__register_frame_inforesunitsecore_event_type_newepsilon_freeecore_list_newecore_dlist_goto_firstepsilon_thumb_size_edataecore_evas_buffer_pixels_getstrerrorclosedirminolta_ifducommenttagsMD5TransformECORE_CON_EVENT_SERVER_DATAstatopendirmemcmpstrncpyevas_object_moveexitecore_evas_freebyteReversecanon_propsnprintfolympus_ifdputcharsubjdistdlopenstrcatmetermodeslibdl.so.1SISCD_2.3libnsl.so.1SUNWprivate_1.1libm.so.2SUNW_1.1libc.so.1libgcc_s.so.1GCC_3.0libImlib2.so.1libepeg.so.0libedje.so.0libecore.so.1libecore_job.so.1libecore_x.so.1libecore_evas.so.1libecore_con.so.1libecore_ipc.so.1libecore_txt.so.1libecore_config.so.1libecore_file.so.1libecore_desktop.so.1libecore_dbus.so.1libcurl.so.3libidn.so.11libssl.so.0.9.8libcrypto.so.0.9.8libsocket.so.1libevas.so.1libfreetype.so.6libfontconfig.so.1libX11.so.4libXext.so.0libXrender.so.1libXp.so.1libXrandr.so.2libiconv.so.2libeet.so.0libz.solibjpeg.so.62libembryo.so.0libepsilon.so.0/usr/local/lib:/opt/csw/lib:/usr/sfw/lib:/usr/openwin/lib k zt v  Nq   ='   ='   y&P FRF}F}F RF$RF(F,F00F4XF8hF<pF@xFDFHFLFPFTFXF\F`FdFhFlFpFtFxF|0FXF8FFFHF F@FhFFFFFFFF@F~FFFFFFFFFF`F8F~F~F~ F~(G~ G~G~G ~$G~G0GXGG G$G(G,G0G4G8G<G@DGDGHRGLGPGTPGXG\`G`GdGhpGlGpGtGxG|GGGG G@GPGPG_G~4GYGXGRGVG^<GXXGG0G8G_G_8G~8GHGGGGGGGGGGHHHH  HH(HHH H$`H(hH,H0H4H8H<H@0HDhHHHL0HP8HTXHX`H\H`hHdHhHlaHp~<HtHxH|dH~HH~XH~LH~PH~TH~DH~@H$H'H(8H(@H(HH'H(PH'H(XH(`H(hH(pH'H(xH(H(H'H(H(0H(H(H(H((H(H(I(I(I(I (I)(I~\IeHIl I l I$*PI(,`I,,I0,I4,I8,hI<,I@ntIDlIH~`IL-IP.IT.(IX.8I\.HI`.XId.hIh.Il.Ip.It.Ix.I|oxI~dIRIGIII]IIIITI!IuIIIIIIZIIIRRRSVxSS V`SSVHS S$VHS,S0V S8S<USD SHUSP@STUS\XS`UShpSlUhStSxU@SSUSSUSSTSSTSSTS(STSHSTShSThSST0SSTSTT TTT$T,T4 T<(TD8TLPTTpT\TdTlTtT|TTTTTT(T@TTXT`TTpTTTTU`U XUUU$U,U4(U<UDHULPUTXU\pUdUlUtU|UUUUUUUU U@U`UUxUUUUVV V(VV$HV,XV4hV<VDVLVTV\VdVlVtV|VVVVX@V VXVVUV8VXVXVWVhVWVpVUhVVTVVWWWTW WWWWWhW$W(UW0W4WPW<W@VHWHWTHW\PWdWlWtW|W WW8W@WXWW WhWxWWWWWWPWXX XXX$XX,X4X<XDPXLHXTX`XdXt(Xx8XPX`XxXXYXXXXXXXY XXY(Y Y8Y@Y HY(PY0XY8`Y@hYHpYPxYXY`YhYpYxYYYYYYYYYY(Y0Y8YHYPYYhZxZZZ^$Z$Z(Z8Z<Z@^ZLZPZT]Z` Zd0Zh]Zt@ZxPZ|]dZ`ZpZ]DZZZ\ZZZZZ\ZZZ\Z Z Z\[ [ 0[\[ H[ X[\l[( h[, x[0\<[< [@[P [T [X[[d [h [x [| [ [ [ ([ 8[ H[ X[ h[ x[ [ [([ \ \ \ \ \  \( \0 \8\@ \H\P \X 8\` H\h\p `\x p\ x\\\ \ \ \ \\ \ \ \\ \ \ \ ] ] ]8] ]  ]( ]0 (]8 8]@]H H]P P]X X]`]h `]p p]x ] ] ] ] ]] ] ]]P]]H] ] ] ] ] ^^ ^ ^ ^ ^( 0^0 ^8^D 8^H H^X `^\ p^l ^p ^ ^ ^ ^ ^ ^ ^^^ ^0^ ^0^@^P_ _h_x_$_,_4_@_D_T_X_h_l_|(_8_H_X_a_h_x_a___a___a\___a<__`` `a`(` 8`0H`4X`8``Dh`Hx`L``X`\````l`p`t``(`8``````````````aaaa(a 8a(Ha0Pa8a@XaHaP`aXa`ahhappaxxaaaaPaaaaaaaaaaaabbbbb,b0b4db@ bD0bHd`bT@bXPb\d@bhhblxbpd@b|bbdbbbbbdbbbcbb bdb8bHbcbXbhbdcc cccc c$chc0c4c8cPcDcHcTc\cd(clct0c|(cc@c(cPcXchcxcccccc(cPcc(dd d(dPd$d,d4d<(dDdL dT(d\(ddPdl0dt@d|Hdhdddd(dddddd(ddd d0d@eXe xeee$e,e4(e<XeDeP(eT8eXkedPehhelkexxe|ekleeekDeeek eeejeeeje(e@ePe`fpffff jf,f0f4jf@fDfTfXf\jtfhfl0f|@fXfhfxfffffjffffffg0g Hgjg`g pg0g4gDgHgXg\g`jTglgpgtjg g (g @g Pgig hg xgig g gjg g gig g gi|g g!h ! h!0h !Hh$!Xh(jh4!hh8!xhH!hL!h\!h`!hdiThp!ht!hxi<h!h"hi$h"h"(hhh"8h"Phhh"`h"ph"h"h"h"h"h"i"iii"i "i("i0#i8"i@#iH# iP"iX#(i`#0ih#8ip#@ix"i#Hi#Xi#hi#xi#i"i#ii"i#i#i#i#i"i#i#j#j$j#j"j $j($j0"j8$ j@$0jH$8jP"jX$Hj`$jh$Pjp"jx$Xj$`j$hj"j$pj$xj"j$j$j$j"j$j$j$j$j$j%k%k"k%k% k %0k(#k0%8k8%@k@"kH%PkP%`kX%pk`%kh"kp#kx%k%k%k%k%k%k%k%k"k%k&k& k&0k"k&8k&Hk&`l# l"l"`l"pl(&xl,&l<&l@&lP&lT&ld&lh'lx'0l|'@l'`l'pl'l'l"l'l)0l)@ln<l)Pl)`ln$l)pl)lmm)m)m mm)m)m mm,)m0)m@)mD*mT*mX*(m\mtmh*8ml*@mx*Pm*Xm*8m*`m*hm*pm*m*m*m*m*8m*m*m*m*m*8m*n*n*n+n+n *8n(+ n0+(n8*8n@+8nH+HnP+XnX+hn`+xnh+np*8n|+n+n)Pn)`n)0n)@n)n)n+n+n+n+n,n,o, o ,0o)po )o0*o4*(oD,@oH,PoX)o\*ol*8op*@o,o,o,o,op0o-o-opo-(o-8o-Ho-Xo-po-o-o-p -p-p-p$-p,-p4-p<-pD-pL-pT=p\=pd=(pl=pt=8p|=@p=Hp=p=8p=Pp=Xp=p=`p=hp=xp=p=p=p=p=p=p=q=q =q=q=q$=q,=q4=q<=qD=8qL>qT=q\>qd=ql>(qt=q|>0q>@q>Xq>pq>q>q>q=q>q>q=q>q7`q>q?q?(q?@r?hr ?r?r?r$?r,?r4@r<@(rD@@rL@prT@r\@rd@rlA0rtAPr|Ar=r=rArArAr7`rArArBrBrB(rB@rBXrBprBrBsBs BsBsBs$Bs,Bs4=s<=sDBsLCsTCs\C sdC0slC8stBs|=sC@sCPsCXsC`sChsCpsCxs=s>0s=sCsCsCsCsCsCtCt =tCtDt$=t,Dt4D(t<=tDD8tLD@tTDHt\DPtdD`tl=ttDpt|DtDtDtDtDtDtDt=tEtEt=tE tE0t=tEPtE`tEpuEuEu Eu,Eu8EuDEuPEu\EuhEutEuEuEuFuFuuuuuvv v v4.v8.vH.vL.v\.v`.vp/vt/(v/@v/`v/xv/v/v/v/v/v/v/v/w/w0w0 w$08w(0Hw80`w<0pwL0wP0w`0wd0wt0wx0w1w1(w1@w1Pw1`w1xw1w1w1w1w1w1x1x1x2x20x(2Xx<2hxP2xxT2xd2xh2xx2x|2x3 x38x3Xx3px3x3x3x3x3y4y4y4y4(y,48y04@y@4PyT4`yX4pyh4y|4y4y4y4y4y5y5y5(y5@y5Hy5hy5xy5y5z5z 5z5z 5z06z46 zD68zH6PzX6`z\6pzl6zp6z6z6z6z6z6z7z7 z70z7@z7Pz7`z7`z7hz7x{ 7{7{ 7{$7{47{87{H7{L7{\8{`80{p8X{t8p{8{8{8{8{8{.{9{.{9{9({9@{9X{9x|9|9|9|$9|(9|8:|<:(|L:H|P:h|`:|d:|t:|x:|:|:|:|:|;|;|3|;(|;H|;X|;h|;x};};};};}(;},;}<<}@<(}P<@}T}Dxn}l}x<}%z$7w|T|vx&}zJJJGJ(lJ4J@_JLyJXJdJp6J|JJJJJJ{JJ J'JvKK eKK$ K05K<YKHKT8K`KlhKxKaKcKKKKKKKoKKLVL L L,pL8*LDLP\L\LhLtLLLL@LLLLLL^L#L"M3MMM(M4rM@MLWMXMdMp M|jM+MMMMMM[MMM}NN NN$QN00N<wNHNTmN`XNlNxN,NgNNiNdNNNfN~NNOOO O,xO8OD1OP2O\OhbOtqOtOOHOCO=OOO|OIOOzPPPP(?P4P@PLPXkPdPpP|PPPP;PPEPK㿠@;@ ]㿠@㿐#/t`  @  `@@`" `@$@``c|``@u`  +㿐㿐/sͮ؂c ` @t ``c `@t㿐㿐 /s@( L#` `/  @tǐ `  @tÔ &0@t"" " " " " " " @t!& & & 㿐      @t@t  @t@t@t㿐/s@t `  @t/sᬂ``    -''X'\'`'dतhhX @tn@$@tk@tk `G!?cc@t` `$`@t[ 7') X@tS , @tQ @tO  $@t5@tH @tF@tE@@tF @t. 2ݢ 0@t=?@t<㿐   `" & @s& @s`:` @ @ 0`@" "   `/r$`  ` '`'X'\  %  `!)'  hhX@s$@sŐ@sŒ`  ` @s& /rD * `$`$@s@sɐ@s@sƒ@sƐ``  p`0`  **``*?@sup㿐       @sd@sb  @s@sZ@sX p/ri  @s Y @s_  @s  $  `'( `(E  `(?@sp @sn  @sl耠`@si0ڔ@sg $ &@s` $ @s   : : :: " <   $ 耢 @r$ @r$   `  㿐/q0`,@s `0`4"@s `8@s  `@`<@s  `H`D@r  `L #/qî``P'- TX  'X'\ '` `2 `.@r$   @r$ y $L   ``X$@r@rΒL` &@rm`f `@rn`dX$%`P@rfThX Xh?h$@rY@rY `?h@r " ?h@r 2?h `" ?h@r "  `ܠ ) a2?h @r5   @rh   @rf8P`2D@rc@{ 0 `\X$@r @r^ /p㴢 " ` " @`"  @r  `1``@q(    @q`  ` `l?@r4 p .@r1`@r2 `@r/@   @"۰ @r'װ `(?@q 2`@q` "``a`T@q`@q`h@$@q@q@qА$@q $ @$n'''`̑ JH'@q@q d@q @q@q \@q @q` `X``$```$`@q֒ ^@q@q`@q` I @qє @qА@qѐ@q@qӐ@qҐ@qӠ`t@q= [ .A@qǐ@q`@q. ]'`̑ JH'@q_$`d`Pc`p   @p )0@qg`x` @q` c`|   @p $ @q`  ` " " `! "/?  "+? !*`0`*0`` `?`@`? * 2 *0`@ " ( "? ` 2 ?@ 2 (  "3   "/  !*`0`*0`` `?`@`? * 2 *0`@ " ( "  ` 2   @ 2 ( ` 㿐/ol t  p l !b #%"?׬`'c`*0`` `?`@`? * 6 *0``"   ( I ` 6 `" $" @4)" @6  @"  (@aa2 ( "@p ( @  @6 @`8 ( @p  (@2 (  @b"@㿈/n|`@p@p l c     `?@p耢  쀠`@p  " @p~@p  `?@po耢 쀥  @ps0G@o蠒 # @pl耢)@ph `2 @o `@p\"ݰ @pZٰ @pD@pE @pF耢ݒ`@pD@oİ c@p,@@p@p; @p/@  (` @ +`@ (`@ " H;jcc"" &. ``v" " " " 㿀   @@@@5ک@`x@5-@@@`@'@:1@cV@4, @@`@@  @`ۨ@5 - @@` @@0os@b@5` -`@@@`@'@=_@c@5-@@@`@@ @b*@4, @@`@@* @b@5 - @'@`@@ ?Q@a@5` -`@@@` @@ `&@`ج@5-@@@`$@'@"=@c@4, @@`(@@ ?ֺ@c@5 - @@`,@@"W5@c@5` -`@@@`0@@@a"@5-@@@`4@@ ?f@a@4, @@`8@@)P@c@5 - @@`<@@m@`!@5` -`@@@@@@;=@ab@5-@@@@;0,@c@@4, @@@@; @bQ@5 - @@@@;:m@c@5` -`@@@@@@ ;5Ă@`]@5-@@@@ ;@`S@4, @@@@;6(y@b@5 - @@@@;9@cȪ@5` -`@@@@@@;xs@a@5-@@@@;0@c֦@4, @@@@;=5C@a@5 - @@@@ ;V@`@5` -`@@@@@@ ;*x@a@5-@@@@;?;@c@4, @@@@ ;@b٨@5 - @@@@;#J@`@5` -`@@@@@ ;?@aB@5-@@@ ;!}@b@4, @@@;gX@a"@5 - @@@;?yN@` @5` -`@@@@@;)/@bD@5-@@@;@c@4, @@@ ;=҂@c`@5 - @@@ ;/@`p@5` -`@@@@@ ; &߂@bƬ@5-@@@;:I@c@4, @@@;5;̂@`@5 - @@@;"@a@5` -`@@@@@;6u4@`9@5-@@@;9@a@4, @@@;蟂@`@5 - @@@;1+@be@5` -`@@5@@@;= H@bD@5-@5@@ ;ʿ@c@4, @4@@;*@c@5 - @5@@ ;?$@`9@5` -`@@5@@@;Vւ@aì@5-@5@@;#3@`@4, @4@@ ;?@`}@5 - @5@@ ;!a@aѪ@5` -`@@5@@@ ;@bO@5-@5@@;?9@b@4, @4@@;(P@c@5 - @5@@ ;@a@5` -`@@5@@@;=߂@b@5-@5@@;/N@b5@4, @4@@ ; @b@5 - @5@@;:ᴂ@c@5` -`@   @@& @&& & 㿐 .@@& 4 `4 @4`$`? @ @`@l@lߔ@lޒ @lޒ$ ? @@lϐ@lϒ @lϒ? ?@@l• 㿐`0``?@  ? @ ?+`` `  @l6@l @l&`&`&` &`$&`(&`,&`0&`4&`8&`<&`@&`D&`H&`L?@l `@l ``&`P&`T@l@l @l &@㿐/jt@l l @l d``E@lx` T#@c` @ll ` @#@ca0 @l] ` ,#@ca4 @lN ` $@lIc #@`#`#@#`@l>`&@l;`@l6@`@l1@`@l/@@l0@l1 㿐/j` `& @l@`@l@`@l @`@l@@l @l 㿐/j_`@`!@k  㿐/iO`a   @@k  㿐`  ` @j@j@j@j`㿐/i($`@` a@@ h! a @ka@@ Z! @k#`;%'a,@k E@`2@k@ @@k@k 2@@k 0 @k. @k"`2 "`2@k@k@j &@k@jg& 㾐9/i<!'L`'DD!@ki@jM!aa @jU!1 ``ab)+-;! a$(`Р   @kE D$@j)!@`" @ @ b!@ u @k.  @j D`V& @j& ` `#& D@k T`@L $ !@@k x!`@k  P@k` `0`@juD!@@j X` &@j0Oa@ja~`@j\!@jD@j @jL@i & @j@i1 c`   @i @jȐ @i& ` @`@j ` @`  @j @j0@jm0@jj㿐/hp`@jf0 @jf0@@jg@j_ 2㿐/h`  @ie @i_ @i:  a8 `;#c["" " " " ` @ja @j[`@jW@`@jT@㿐   `@$@@h @i`@j:$ @h$$$㿐`   @  @  @ @i @& @j& & @h&  & & 㿈V $/gⴀ`  g`%+` @  a<@i ?䀢 Tb 6  * 2`@?``6 @h r&  @iސa\* 2 @h  (`u * `2q @iΒ*  "j   T+ i m+ +  e d+ + + \ * 2` @?```6 a@i2`& K a<@h ?• `'6 "? ``$@hI -& @iJ* 2 '('@iH* 2 '쑢 (?a`  @h9  (`c@h@@h c@h@@hϒ,R $`` "    ?`2 "  @?``2  㿐V $/f%\ `  @gc  $ ad  @g  (`  @h@@h㿐` @/fĐ@i `*  2 @ ah@hyf `H ;-?ccl`@h@h, 4 2 $" @  @ ``@ (``(``$` `` `$` 4`@hђ   2``  @æ @h4 $`@g]  $`4 ` @gf`(`@h@@h 4 㿈/f@h*  2 @ ? @h * @ 2 ap@g` ;9a<c''at!x`@hi(`@hk4"    " " 2 2 $@hb ^?  4   `  @? ` @(`  .4 @g  ` @g@f 7$@ 8 @ @ @f@f @f@f͐  @`0!@h `Ҫ@fې 4 `4@f@fѐ@(`  4 @g^@@g_ƀ㿀V $/eڮ0  L ?ac  "@ ` @ 5`&  `` &   6 a`@gĒ ` X``"``2Y aa    `8 .`0``(``@gaaD " " @f7 $ ,.0`3`@"'''왠'쑠쑢 ('앢애*?aL#\  @f$  4 "9`X`` ` @  %X ` @g?`* 2@f   @8 0a|@f q$aa a` `@2 @eː \&  # c@gc@gaP @eɒ  m(`2 aa@  _ @@g  Y ` U @f O @M4 @e  & aT  @e ac@f;@@f<``@fȐ .`@fĐ 0 2@f`#c@f#@@f$ c@f@@f+,'쑠애 (?aH  @e]  4 㿐V`/dЀ`-a?c   `& `` `&  ,6 c@ 8a`"+@fk a?c  ނ `& `` `&  6 *`@fG2`c@  & a@eV` $㿈`/c@@a @f8    @f36`a@e@f)㿐 2 0`` `(&@d` @d@d`/cX@d  b$ $$$$$ @e  ޶  aM@aI@$$ @e* 2  *@eސ @eߒ '$b|@' #@ "" *?0`c@ a c @  "` @ b `@d  `Y   @e@@e6@@e 6` @e`` `?``? &` (Q  @e&`ca &`6`  @  @" @  ` , @ `&` `` #x&`6` '`I* @` b(@d  @ $b|@"T#@  @c̀ d'@e* 2 &`@e9  `$T`"X$Wb$ub@d{@d|s  +$$0`|@ &㼚@+`@ ``㼀@  @@ b,@da` 㼂@ (`@ `` `@b0@dP` @dא#a` @ @@@  ` $@@ @4btci@" "aL`*0``"`*0`` `?` `?  *`+``  @ }*0`` `?``? "`( ` @ @ @8*`2`(/$`(`2)#`(c@c@@c͐ @@dw OЀ`/ Б* @dq: ,@`L@` @c@  @c   @c   `4*`2`@d*`&`$@ "4_(b|@2y`"   2cT+`@ ` `"`@$` "_`@2@b ` #@ @@ W*@b  &``@ @d ```w+@`%@2?`   2*!0`#i@"`@c$` 2@(@`@$b4@c: ` @߂#@2`c `@ba  &`  &@  ` +`(`/@cǐ4/@cÐ* b84:` @bQT`a 㼚a@ @ @ @ @ @ 2``"`@͔#``  `@co  ````c, `2``  @ @:``@b cJ?` `  ?"J?@ `2?"@aԐ  &`@cB`(@`K@ @?``6`c@by@@bz0@a &```E`@@c,`@c% : <@@"@c "@  @c@c`` 0+@+``p(``@b `<` I f(@(` n i t e(`(`(`(`(`(`(``U(``@@b`@b͐ @b  `@b@b`"`"`<`< @ #@ @ ̀`@ ̀`'`a@H'a@H ʂa? `@a5 `(``@a X&`*``= 1!'@a0``%@@` @@bė*  @a:`@``@a``%@@`@ @b6* 2@``@@```@(a@a `<` @ #@ @ :`+@  ``''aԑ  @ /a`@` `(`''  r ʒ@baȖ`@` `t(`@baȔ@b``h(`aX?˂b@aǐ0`$/'`,-a@H' ./a@Ha @ `a@H./a@ap/_ଐ@a   @`Wc ' n` $b|@W`$@b@ { @ ]b  ❀@ "`4uba&,`"a#⚂(`0``!((b@a "`"``@@a_``@aX @a:a`@_ `(``"``"```"`*0```(`R$` b|@@`T`c(` @ ``"$@`"@ "+`4x)b@ "`&`b @2`"T``4`T````c@` `&`@ "i`b@2`"``@@a ``'@'@a`'쑠(?@aЀ  a@(?a@a@@H?@`@a'`@_p `(`@_{` 8w`"`@_u , s,  c e, , ,  @b@2d`"?b`6`"`@ "&`=`?ׂa@`8T`",`@`'   ``Ȑ' @`'  䑢I(?@`Ѐ &b@`@?b `@_ `(`@2`"@^  c&`b @_`` (`a@(?Ѐ@2`"0@`q@  `( `  `2 V` 6``"`` ! Kc` `   K` @ `2   K`2` 6```@@` ?"q`@^` 8`"`@^ , E V, , , `@_'  ``Ȑ'ܐ @_'  ܑI(?@`Ѐ  a@(?b ``@_ǒ' w ``Ȑ' @_' d 葢I(?@_Ѐ " a@(?Ղb` @_ 2u`` U k(@(` o w(`(`(`(`(`C(`a@Ja@J`@@_| @ U`(@ u s(`(` e d(`(`(`(` !6``@@_f?2`` I f(@(` i t y(`(`(`(`(`(` (`a@Ja@Ja@bJa@OJ``@@_6`` @_/2`" 6```@_#' 1 ``Ȑ' @_'  I(?@_4Ѐ " a@(?1bc@^K@@^L`"a@Ja@͑J`" (` (` @`" (` (` @ (`8``"  + (` @ +`@  + (` @ +`@ @ `"  + (` @ +`@  + (` @ +`@ @ 㿐/\|   .`0`+ @ @]:`@]  2 `c@]@@]`@^H *`0`@  ( @ 2 ( *`0`@ *8` ( @ 2 (R $@ 2 (08`R $@*㿐/[ @\Ґ , c@]@@]& $?6 $&& & & & & & & & & (㿐@^$ (" ( "     ?& (2" 2 " 2 2 $2 㿐 /[lD #b<@]> &㿈/[Zc@ Lcx   @"V $ ` V $)`"2  `b@   @]bD@]  @]bH@] @]`@\ @]`@\`@] @]   #\bP  @\ 0#\ bL㿐  /[@ .&@@\,c  &@@ `@@]q@4  @ @ (`@ ?   3 # @]u@\ &@@\@@\@ 㿈`@]_  ` @]U  㿐`@]?`㿐/Z(b\?c   `& `` `&  6 c@ " b``@] `% *`@\2`& @[  &   @]    (@ bT@\ $c@\A@@\B p``/ZḠbX@` `'' ''''@[    @\* `0`ؐ@\ԁ㿐/Zb@\@㿐/Z܂b@\@\8`?8`? ?,`@㿐/Zخ|bd ?@[?㿐/ZǮ8b#@#Y  ?@`"&@b%+` @  Qj  0 [& b#@bx#@b|#@lbp @     @ bp .  `@bpl @  b@  `@"bh@[j0Y 2 #Y  M KIbt #XXXXXXXXXXXXXPPXXXXXX㿐/Ylb;&bpbx&@;&b|bt&@㿈  /Y耤   )# `?2  @ `?3@[, 4`$@[?c$`@   @  ``@ (``(``$` `` `$` 4`@[^ #  ,@ #@Yà*`@[A2`$`@[C # 2 + )8 Wa8%,  @ ?逤` ?`4`"`$`$`!  N o**  r m* *  a l* * * ``$``J '쀠`9bb  ʂb?@Y  ?`4`"$``'쀠` b@Hb`$``ڦ  I f**  n i t e* * * * * * * `@Z dl$`$``'쀠` b@Hb``W$`?` S4`"?bO4`"?`K4`"?`"G4`"` 0 @ 8` @ '" $`bH ?@Z``7` b@ 7ȁ@'b`'$``'쀠` bb H@?@Z b@ H@'*b`2@Y  $``b  ` @X  $``'쀠` [bbH @?@Zb b`)?$``" +`  @ ` Ӓ @X  ,c@Yh@@Yi,b'쀠`?b@ (?b@X #`H' kb@Hb@Hb@fHb@ŕHb@ Hb@Xx g b@HpLp`c@ ec8` @W *`@W2`& c(@VV` $` @@W` ` @W`"c '쀤 6'왠쀢 *ʑ (c$ @@W``  @W`xc @V$  6 c@uHc@iHc@ԕHc@ȕH㿈`/T㌰@c,@VJ   6`@WB㿈V $/T cl?c  `& `` `&  K6 c@ " cp`7@V b"; b`0h` @@V``  @V`q 's'왠쀢 |ʑ ( ?c\  @U c<@Vh $*`@V2`& `@V`@Vǐc@cD $ $ $4@V`@V cHcL $$ $4@V @V`cPcT 4$$ 6$@U1 "&  # c@Vvc@Vcd @U/  (`cX @U& c`@Hc@U@@U c`@H㿈`/S㬰@ch@UR  @VM㿐/SHct@?㿐Invalid filename given: %s Epsilon expects the full path to file epsilon_plugin_init.thumbnails.thumbnails/normal.thumbnails/large.thumbnails/fail%s/%sHOME/usr/local/lib/epsilon/plugins/.so/usr/local/lib/epsilon/plugins%s/%s/%s.jpg0123456789abcdeffile://%sjpgmpgmpegvideo/mpegwmvavivideo/x-ms-wmvmovvideo/x-msvideovideo/quicktimelargenormalfail/epsilon%s:%s:%dx%d%s%s/.thumbnails/%s/%s.jpgedjimage/edjeimage/%sKey required for this file type! ERROR!! Cannot load file %s, group %s Cannot create buffer canvas! ERROR! : %s%s%s %s%s%d rberror reading JPEG (length mismatch)couldn't find Exif data!! client connected to server !!!! client disconnected from server !!Receiving dataReceived %d response for %s %s-%sepsilonsocket name %s First childSecond child/usr/local/bin/epsilon_thumbdexeclpconnect to ipc server: %p !! requesting thumbnail for %s !! Failed to connect to server Focusing screenFinder display during exposureShutter release w/o CF cardISO speed expansionShutter button/AEL buttonManual Tv/Av for MExposure level incrementsUSM lens electronic MFTop/back LCD panelsAEB sequence/auto cancellationAF point illuminationAF point selectionMirror lockup# AF points/spot meteringFill flash auto reductionShutter curtain syncSafety shift in Av or TvAF point activation areaSwitch to registered AF pointLens AF stop buttonAI servo tracking sensitivityUnknown functionStandardSlowModerately SlowModerately FastFastUnknownAF StopAF StartAE Lock While MeteringAF Point: M->Auto/Auto->CtrAF Mode: ONESHOT<->SERVOIS StartAssist + AFAssistOnly While Pressing AssistSingle AF PointExpanded (TTL. of 7 AF Points)Automatic Expanded (Max. 13)1st-Curtain Sync2nd-Curtain SyncEnabledDisabled45/Center AF Point11/Active AF Point11/Center AF Point9/Active AF PointH=AF+Main/V=AF+CommandH=Comp+Main/V=Comp+CommandH=Command Only/V=Assist+MainH=FEL+Main/V=FEL+CommandOnOffOn Without DimmingBrighter0,-,+/Enabled0,-,+/Disabled-,0,+/Enabled-,0,+/DisabledRemain. Shots/File No.ISO/Remain. ShotsISO/File No.Shots In Folder/Remain. ShotsTurns On After One-Shot AFTurns Off After One-Shot AFAlways Turned Off1/3-Stop Set, 1/3-Stop Comp1-Stop Set, 1/3-Stop Comp1/2-Stop Set, 1/2-Stop CompTv=Main/Av=ControlTv=Control/Av=MainTv=Main/Av=Main w/o LensTv=Control/Av=Main w/o LensAF/AE Lock StopAE Lock/AFAF/AF Lock, No AE LockAE/AF, No AE LockYesNoNo Viewfinder DisplayFinder Display OnEc-N, REc-A,B,C,CII,CIII,D,H,I,LLong exposure noise reductionShutter/AE lock buttonsTv/Av and exposure levelAF-assist lightAv mode shutter speedMenu button return positionShooting Set button functionSensor cleaningSuperimposed displayNot AssignedChange QualityChange ISO SpeedSelect ParametersTopPrevious (Volatile)PreviousOperate AFLock AE & Start TimerAuto1/200 (Fixed)1/2 Stop1/3 StopAF/AE LockAF/AF LockAE+Release/AE+AFCanonColorTempColor TemperatureCanonUnknownCanon TagA0 UnknownCanon4LenCanon Tag4 LengthCanonWhiteBWhite BalanceCanonSequenceSequence NumberCanonAFPoint2Autofocus PointCanonFlashBiasFlash BiasCanonSubjDstSubject DistanceCanon Tag4 Unknown0 EV0.33 EV0.50 EV0.67 EV1 EV1.33 EV1.50 EV1.67 EV2 EV-2 EV-1.67 EV-1.50 EV-1.33 EV-1 EV-0.67 EV-0.50 EV-0.33 EVDaylightCloudyTungstenFluorescentFlashCustomBlack & WhiteShadeManual TemperatureCanon1LenCanon Tag1 LengthCanonMacroModeMacro ModeCanonTimerLenSelf-Timer LengthCanonQualityCompression SettingCanonFlashModeFlash ModeCanonDriveModeDrive ModeCanonFocusModeFocus ModeCanonImageSizeImage SizeCanonShootModeShooting ModeCanonDigiZoomDigital ZoomCanonContrastContrastCanonSaturateSaturationCanonSharpnessSharpnessCanonISOISO Speed RatingCanonMeterModeMetering ModeCanonFocusTypeFocus TypeCanonAFPointCanonExpModeExposure ModeCanonMaxFocalMax Focal LengthCanonMinFocalMin Focal LengthCanonFocalUnitsFocal Units/mmCanonFlashActFlash ActivityCanonFlashDetFlash DetailsCanonDZoomResZoomed ResolutionCanonBZoomResBase Zoom ResolutionCanon Tag1 UnknownEasy ShootingProgramTv-PriorityAv-PriorityManualA-DEPDEPClose-Up (Macro Mode)Infinity ModeLocked (Pan Mode)EvaluativePartialCenter-Weighted50100200400NormalHighLowFull AutoLandscapeFast ShutterSlow ShutterNightSepiaPortraitSportsMacro/Close-UpPan FocusLargeMediumSmallOne-ShotAI ServoAI FocusSingleContinuousRed-Eye ReductionSlow-SynchroRed-Eye Reduction (Auto)Red-Eye Reduction (On)External FlashFineSuperfineMacroCanon1TagCanon Tag1 OffsetCanon4TagCanon Tag4 OffsetImageTypeImage TypeFirmwareVerFirmware VersionImgNumImage NumberOwnerNameOwner NameSerialSerial NumberCustomFuncCustom FunctionCanonA0TagCanon TagA0 OffsetCanon UnknownNonex2x4%d secx%.1f%d KCanon maker tag appears corruptnum %02d, val 0x%04XCanon custom tag appears corrupt%s - %s%s %d - %dProcessing Canon Maker NoteCanonLensSzLens Size%.2f - %.2f mm Unknown (%d): %d, 0x%04X %03d-%04d%010d%.2f mmCasioASCII1Casio ASCII Val 1CasioASCII2Casio ASCII Val 2CasioASCII3Casio ASCII Val 3CasioUnknownCasio UnknownCasioRecordRecording ModeCasioQualityQuality SettingCasioFocusFocusing ModeCasioFlashFlash ModeCasioIntensityFlash IntensityCasioDistanceObject DistanceCasioWhiteBWhite BalanceCasioDZoomDigital ZoomCasioSharpSharpnessCasioContrastContrastCasioSaturateSaturationCasioSensitiveSensitivityNormalHigh+1.0+3.0+2.0UnknownLowSoftHardAutoTungstenDaylightFluorescentShadeManualWeakStrongOnOffRed Eye ReductionMacroInfinityEconomyFineSingle ShutterPanoramaNight ScenePortraitLandscapeProcessing Casio Maker Note (%d) QVCCasio maker note version not supportedExifinvalid TIFF headerinvalid Exif format (couldn't read IFD0)Processing %s directory, %d entries unknown TIFF field typeProcessing directory %d, %d entries field type mismatchfield count mismatchmaker note not supportedinvalid Exif format (IFD length mismatch)%d.%d%.1f%d, %d/%d%dA?%d dp%s1/%df/%.1f%d mm%.2f mm%.2f m@?A?-  %02X %s (0x%04X): %s, %d; %d | %s (%d): %s, %d; %d, 0x%04X %s (0x%04X): %s, %d; %d, 0x%04X FujiVersionMaker Note VersionFujiQualityQuality SettingFujiSharpnessSharpnessFujiWhiteBalWhite BalanceFujiColorChroma SaturationFujiToneContrastFujiFlashModeFlash ModeFujiFlashStrengthFlash StrengthFujiMacroMacro ModeFujiFocusModeFocus ModeFujiSlowSyncSlow Synchro ModeFujiPicModePicture ModeFujiBracketContinuous/Bracketing ModeFujiBlurWarnBlur StatusFujiFocusWarnFocus StatusFujiAEWarnAuto Exposure StatusFujiUnknownFuji UnknownOKOver ExposedUnknownOut of FocusBlur WarningAutoPortraitLandscapeSports SceneNight SceneProgram AEAperture Prior AEShutter Prior AEManual ExposureManualOffOnRed Eye ReductionNormalHighLowDaylightCloudyDaylight Color FluorescenceDaywhite Color FluorescenceWhite FluorescenceIncandescenceCustomSoftHardProcessing Fuji Maker NoteFUJIFILMBaselineExtended sequentialProgressiveLosslessDifferential sequentialDifferential progressiveDifferential losslessExtended sequential, arithmetic codingProgressive, arithmetic codingLossless, arithmetic codingDifferential sequential, arithmetic codingDifferential progressive, arithmetic codingDifferential lossless, arithmetic codingUnknowninvalid JPEG marker (length mismatch)invalid JPEG SOF marker (length mismatch)unknowncanonolympusfujifilmnikoncasiominoltaMinoltaExpProgExposure ProgramMinoltaFlashModeFlash ModeMinoltaWhiteBWhite BalanceMinoltaSizeImage SizeMinoltaQualityImage QualityMinoltaDriveModeDrive ModeMinoltaMeterModeMetering ModeMinoltaFilmSpeedFilm SpeedMinoltaExpTimeExposure TimeMinoltaApertureLens ApertureMinoltaMacroMacroMinoltaDigiZoomDigital ZoomMinoltaExpCompExposure CompensationMinoltaBracketStepBracketing StepMinoltaIntrvlTimeInterval TimeMinoltaIntrvlPicsInterval PicsMinoltaFocalLenFocal LengthMinoltaFocusDistFocus DistanceMinoltaFlashFlash FiredMinoltaDateDateMinoltaTimeTimeMinoltaMaxApertureMaximum Lens ApertureMinoltaRmbrFileNumFile Number MemoryMinoltaSequenceSequence NumberMinoltaSaturateSaturationMinoltaContrastContrastMinoltaSharpnessSharpnessMinoltaSceneScene Capture TypeMinoltaFlashCompFlash CompensationMinoltaISOISO Speed RatingMinoltaModelCamera ModelMinoltaIntervalModeInterval ModeMinoltaFolderFolder NameMinoltaColorModeColor ModeMinoltaColorFiltColor WarmingMinoltaBWFiltBlack & White ToneMinoltaIntFlashInternal FlashMinoltaFocusXAF Point XMinoltaFocusYAF Point YMinoltaWFocusZoneAF ZoneMinoltaFocusModeFocus ModeMinoltaAFAreaWide Focus AreaMinoltaBracketModeBracketing ModeMinoltaDataImprintData ImprintMinoltaUnknownMinolta Field UnknownNoneDataTime Y/M/DDataTime M/D H:MTextText + IDUnknownExposureFilterWide AreaSpot Focus PointAutoManualNo ZoneCenterLeftRightNatural ColorBlack & WhiteVivid ColorSolarizationAdobe RGBStandardDiMAGE 7DiMAGE 5DiMAGE 7iDiMAGE 7Hi100200400800NormalPortraitNight PortraitSunsetSports ActionHardSoft1/31/21NoYesMulti-SegmentCenter Weighted AverageSpotSingle FrameContinous AdvanceSelf TimerBracketingIntervalUHSHSRawSuper FineFineEconomyExtra Fine2560x19201600x12001280x960640x480DaylightCloudyTungstenCustomFlourescentFlourescent 2Custom 2Custom 3Fill FlashRed-Eye ReductionRear SyncRemoteProgram AEAperture PriorityShutter PriorityMinoltaMakerTypeMinolta Maker Note TypeMinolta1TagMinolta Tag1 OffsetMinolta3TagMinolta Tag3 OffsetMinoltaCompImgSzMinolta Compressed Image SizeMinoltaThumbOffMinolta Thumbnail OffsetMinoltaThumbLenMinolta Thumbnail LengthMinoltaPIMMinolta Print Image ManagementMinolta Unknown%+0.1f EV%0.6f%02f1/%d%d%02d:%02d:%02d%0.1f%02d/%02d/%04d%+d%.1fA@@?p@??@ ??ADzn/aProcessing Minolta Maker NoteMinolta maker note not fully supported0TLMmlt0Minolta maker note version not supported+MNikonQualityImage QualityNikonColorColor ModeNikonImgAdjustImage AdjustmentNikonCCDSensitiveCCD SensitivityNikonWhiteBalWhite BalanceNikonFocusFocusNikonDigiZoomDigital ZoomNikonAdapterLens AdapterUnknownNikon UnknownNoneFisheyeAutoPresetDaylightIncandescentFluorescentCloudySpeedlightISO 80ISO 160ISO 320ISO 100NormalBright(+)Bright(-)Contrast(+)Contrast(-)ColorMonochromeVGA BasicVGA NormalVGA FineSXGA BasicSXGA NormalSXGA FineNikonISOSetISO SettingNikonSharpImage SharpeningNikonFocusModeFocus ModeNikonFlashSetFlash SettingNikonISOSelectISO SelectionNikonFocusDistFocus Distancex%.1fProcessing Nikon Maker Note (%d) N/Ax%.1f mANikonOlympusShootModeShooting ModeOlympusQualityCompression SettingOlympusMacroModeMacro ModeOlympusDigiZoomDigital ZoomFirmwareVerFirmware VersionOlympusPicInfoPicture InfoOlympusCameraIDCamera IDUnknownOlympus UnknownNormalMacroSQHQSHQProcessing Olympus Maker Notex%.1fOlympusPicModePicture ModeOlympusSeqNumSequence NumberOlympusPanDirPanoramic Direction%03d-%04dNoneAOLYMPImageWidthImage WidthImageLengthImage HeightBitsPerSampleNumber of Bits Per ComponentCompressionCompression SchemePhotometricInterpretationPixel CompositionFillOrderDocumentNameImageDescriptionTitleMakeEquipment MakeModelCamera ModelStripOffsetsImage Data LocationOrientationImage OrientationSamplesPerPixelNumber of ComponentsRowsPerStripNumber of Rows Per StripStripByteCountsBytes per Compressed StripXResolutionHorizontal ResolutionYResolutionVertical ResolutionPlanarConfigurationImage Data ArrangementResolutionUnitResolution UnitTransferFunctionTransfer FunctionSoftwareCamera SoftwareDateTimeImage CreatedArtistPhotographerWhitePointWhite Point ChromaticityPrimaryChromaticitiesChromaticities of Primary ColorsTransferRangeJPEGProcJPEGInterchangeFormatOffset to JPEG SOIJPEGInterchangeFormatLengthBytes of JPEG DataYCbCrCoefficientsColor Space Xform Matrix Coeff'sYCbCrSubSamplingChrominance Comp Samp RatioYCbCrPositioningChrominance Comp PositioningReferenceBlackWhiteBlack and White Ref Point ValuesCFARepeatPatternDimCFAPatternBatteryLevelCopyrightExposureTimeExposure TimeFNumberF-NumberIPTC/NAAExifOffsetExif IFD PointerInterColorProfileExposureProgramExposure ProgramSpectralSensitivitySpectral SensitivityGPSInfoGPS Info IFD PointerISOSpeedRatingsISO Speed RatingOECFOpto-Electric Conversion FactorExifVersionExif VersionDateTimeOriginalImage GeneratedDateTimeDigitizedImage DigitizedComponentsConfigurationMeaning of Each CompCompressedBitsPerPixelImage Compression ModeShutterSpeedValueShutter SpeedApertureValueLens ApertureBrightnessValueBrightnessExposureBiasValueExposure BiasMaxApertureValueMaximum Lens ApertureSubjectDistanceSubject DistanceMeteringModeMetering ModeLightSourceLight SourceFlashFocalLengthFocal LengthSubjectAreaSubject AreaMakerNoteManufacturer NotesUserCommentCommentSubsecTimeDateTime Second FractionSubsecTimeOrginalDateTimeOriginal Second FractionSubsecTimeDigitizedDateTimeDigitized Second FractionFlashPixVersionSupported FlashPix VersionColorSpaceColor Space InformationPixelXDimensionPixelYDimensionRelatedSoundFileRelated Audio FileInteroperabilityOffsetInteroperability IFD PointerFlashEnergyFlash EnergySpatialFrequencyResponseSpatial Frequency ResponseFocalPlaneXResolutionFocal Plane Horiz ResolutionFocalPlaneYResolutionFocal Plane Vert ResolutionFocalPlaneResolutionUnitFocal Plane Res UnitSubjectLocationSubject LocationExposureIndexExposure IndexSensingMethodSensing MethodFileSourceFile SourceSceneTypeScene TypeColor Filter Array PatternCustomRenderedRenderingExposureModeExposure ModeWhiteBalanceWhite BalanceDigitalZoomRatioDigital Zoom RatioFocalLenIn35mmFilmFocal Length (35mm Equiv)SceneCaptureTypeScene Capture TypeGainControlGain ControlContrastSaturationSharpnessDeviceSettingDescrDevice SettingsSubjectDistRangeSubject Distance RangeImageUniqueIDUnique Image IDUnknownMacroClose ViewDistant ViewNormalLowHighSoftHardNoneLow Gain UpHigh Gain UpLow Gain DownHigh Gain DownStandardLandscapePortraitNight SceneAutoManualAuto BracketCustomDirectly PhotographedDSCNot DefinedOne-Chip Color AreaTwo-Chip Color AreaThree-Chip Color AreaColor Sequential AreaTrilinearColor Sequential LinearsRGBUncalibratedNo FlashFlash, Return Not DetectedFlash, Return DetectedFlash, CompulsoryFlash, Compulsory, Return Not DetectedFlash, Compulsory, Return DetectedNo Flash, CompulsoryNo Flash, AutoFlash, AutoFlash, Auto, Return Not DetectedFlash, Auto, Return DetectedNo Flash FunctionFlash, Red-Eye ReduceFlash, Red-Eye Reduce, Return Not DetectedFlash, Red-Eye Reduce, Return DetectedFlash, Compulsory, Red-Eye ReduceFlash, Compulsory, Red-Eye Reduce, Return Not DetectedFlash, Compulsory, Red-Eye Reduce, Return DetectedFlash, Auto, Red-Eye ReduceFlash, Auto, Red-Eye Reduce, Return Not DetectedFlash, Auto, Red-Eye Reduce, Return DetectedDaylightFluorescentTungstenFine WeatherCloudy WeatherShadeDaylight FluorescentDay White FluorescentCool White FluorescentWhite FluorescentStandard Light AStandard Light BStandard Light CD55D65D75D50ISO Studio TungstenOtherAverageCenter Weighted AverageSpotMulti SpotPatternPartialDoes Not ExistYCbCrRGBNormal ProgramAperture PriorityShutter PriorityCreativeActionPortrait ModeLandscape ModeCenteredCo-SitedYCbCr4:2:2YCbCr4:2:0icmChunky FormatPlanar FormatTop, Left-HandTop, Right-HandBottom, Right-HandBottom, Left-HandLeft-Hand, TopRight-Hand, TopRight-Hand, BottomLeft-Hand, BottomRGBYCbCrUncompressedJPEG Compression (Thumbnail)ASCIIJISUNICODEbyteasciishortlongrationalsbyteundefinedsshortslongsrationalfloatdoubleunknownP00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|000000000000 0|0y$0v00s<0pH0mT0j`0gl0dx0a0^0[0X0U0R0O0L0I0F0C0@       ( ; M _ q        k     , ? K X h s        u< uX      oq.o#ond$0Q ooI      ,04@     $%       0    @Pd}    !01      !"#$%&'()*+-./0123 @  4   AEGIMOY]_       (-12;>?Vis"$%'(     |        !#$0/pcndu< uX ul  F IPRRRRRRu} !"# ~t ".}7RB Qaut |v, \v  RRRRwv }}RR  0  X h p x & - 4 ; B I P W ^ e l s z  0 X 8   H  @ h        @ { ~      #3@   `  8 I~U~h~ n~( u~ ~~~$~0 X         L DP  QR+3X@?( LU(l X^ f]r]d@VH\h Vx]HP  `  \0 p        % - 5 =@ ET08S[@aTpT0}V`UU@(W WU(T(P PT _ T \<0U(+~42YXAUh(N\l ZTh fU v^$U T \ X]D Wh(V (Y W WPWX(!Y.X;8 HRWVg^<rXX( 0 8 a(__8Pa< a8` +~8` a0a  a\(`8'H        & - 4 ; B I P W ^ e( l s z ` h      0 h  .0 8 X `  h 9@d(L S ZcPcchoaTycPd`Hd@ +~<d0ccd  dp~H~X~L݌@ ~P, "~T,~D6(d ?~@FOYjfk(tj@j k 8$ ' (8 (@ (H ' (P ' (X (` (h (p ' (x ( ( $' ,( 4(0 <( D( L( T(( \( d( l( t( |( ( )( jT  klP kD( i<+~\ i( i$ i0 eH h( l  *i 9k( Fl  SiT( ejt  wi|0 h0 j8 -*P ,` , , , ,h , nt l n$ mt m( m@+~` n<8 $m0 1B- I. P.( W.8 ^.H e.X l.h s. z. . . . ;ox Hp0 +~d Xp fQ pR  } RR R R   (D $ z8 2 ; B Zu atX ol |xL <  ~    "    !~( 7 >Tl O V ] q  Yq  Dd qh z  R8q t  z<T q@%,v 8x A Y~t^ o  s@z qX H t( tpH. Tq^\ gPp ~h  d\ \ | h  } sPuX #(D 1~l:uArK`fz qF ,2 J Ydp\ zԐ4 tL  d,    '| /6d >V[tt eu p( %5qx@@ KQpp Zbtmh ~l xT F p tl \   &-@ \ Kp0TYagRtՄ ڤ0 H\ I4 ~ph~hT ,H  +: Xgu"u< t@w 4 }'0lx <t(tv,EL L Rns{@ \ T` pP s8H.libs/libepsilon.so.0.0.1crti.svalues-Xa.cBbss.bssDdata.dataDrodata.rodatacrtstuff.ccall___do_global_dtors_auxcall_frame_dummyforce_to_data__CTOR_LIST____DTOR_LIST____EH_FRAME_BEGIN__object.2completed.1p.0__JCR_LIST__Epsilon.c.LLC10.LLC11.LLC12.LLC13.LLC14.LLC15.LLC16.LLC17.LLC18.LLC19.LLC20.LLC21.LLC22.LLC23.LLC24.LLC25.LLC26.LLC27.LLC28.LLC29.LLC30.LLC31.LLC32.LLC33.LLC34.LLC35.LLC36.LLC0.LLC1.LLC2.LLC3.LLC4.LLC5.LLC6.LLC7.LLC8.LLC9hex.0epsilon_hashplugins_mimeEpsilon_Exif.cmd5.cepsilon_thumb.cepsilon_cb_server_addepsilon_midepsilon_server_deldebugbufferepsilon_server_dataepsilon_server_addepsilon_request_queueepsilon_init_countepsilon_serverepsilon_event_freeepsilon_cb_server_delepsilon_cb_server_dataepsilon_thumb_common.ccanon.cccstm_offoncanon_customccstm_afselcanon_qualitycanon_drivecanon_focus1ccstm_yesnocanon_shootcanon_propA0ccstm_fscrcanon_flash.LLC280.LLC281.LLC282.LLC283canon_iso.LLC284.LLC285.LLC270.LLC271.LLC272.LLC273.LLC274.LLC275.LLC276.LLC277.LLC278.LLC279ccstm_lensaf1canon_expmodeccstm_shutsyncccstm_aisensccstm_finderccstm_disenccstm_afillccstm_lensafccstm_autooffccstm_tvavformccstm_afspotcanon_prop01canon_prop04canon_dzoomccstm_endiscanon_focustypeccstm_lcdpanelsonce.0canon_whitebalccstm_aebseqcanon_meterccstm_regafccstm_explvlinccanon_macroccstm_usmmfccstm_afactcanon_rangeccstm_explvlcanon_imageszccstm_setbutccstm_shutteraelcanon_fbiasccstm_menubutccstm_onoffccstm_shutspdccstm_shuttercanon_tags01canon_tags04canon_subvalcanon_1dcustomcanon_d30customcanon_tagscanon_tagsA0casio.c.LLC61.LLC62.LLC63casio_focuscasio_tags0casio_tags1casio_intensecasio_whitebcasio_rangecasio_sharpcasio_recordcasio_qualcasio_flashcasio_sensitiveexif.cexifutil.cfuji.cfuji_flmode.LLC64.LLC65fuji_aewfuji_focuswfuji_tagsfuji_picturefuji_whitefuji_colorfuji_sharpfuji_focusfuji_blurwfuji_booljpeg.cedje_message_signal_processjpg_cmpntsseensofjpg_heightmkrlenjpg_widthjpg1bytejpg_prcssjpg_prcsnjpg2byteinfilemakers.cminolta.cminolta_boolminolta_flashminolta_driveminolta_metermodeminolta_quality.LLC120.LLC181.LLC182.LLC183.LLC184.LLC185.LLC186.LLC187.LLC188.LLC189.LLC190.LLC191.LLC192.LLC193.LLC194.LLC195.LLC196.LLC197.LLC198.LLC199.LLC200.LLC201.LLC202.LLC203.LLC204.LLC205.LLC206.LLC207.LLC208.LLC209minolta_sharpminolta_whitebalminolta_sizeminolta_focusmodeminolta_modelminolta_focusareaminolta_isominolta_0TLMminolta_brackmodeminolta_tagsminolta_folderminolta_progminolta_unknminolta_widefocusminolta_brackstepminolta_colorminolta_imprintminolta_scenenikon.c.LLC56.LLC57.LLC58.LLC59.LLC60nikon_tags0nikon_tags1nikon_colornikon_convertnikon_ccdnikon_whitenikon_qualitynikon_adjustolympus.colympus_tagsolympus_qualityolympus_macrotagdefs.c__DTOR_END__call___do_global_ctors_aux__CTOR_END____JCR_END____FRAME_END__crtn.s_END__START_epsilon_info_exif_props_as_int_getminolta_propepsilon_exif_info_freeepsilon_resolution_setexifscanfcloseimlib_context_set_imageftypesplanarconfigsolympus_propepsilon_plugin_loadMD5Initepeg_quality_setepsilon_mime_for_extension_gettolowerfseekpow__deregister_frame_infoexiffreeepeg_thumbnail_comments_enablefwriteepsilon_info_exif_getstrcpyepsilon_generategetenvcallocepsilon_message_newecore_str_comparesprintfstrncmpfilesrcsepsilon_file_getimlib_load_image_immediately_without_cachequietcompresssecore_list_goto_firstepsilon_key_setcustomrendepeg_encodememcpyepsilon_newjpeginfoepsilon_ipc_client_send_endepsilon_ipc_pushecore_con_client_sendecore_con_server_sendfopencasio_ifdMD5Updatedlsymcompconfigepsilon_thumb_file_getscenetypes_lib_versionhexprintchromratios.uremorientsatoievas_object_showepsilon_info_exif_props_as_string_getcolorspcsdumpprop_DYNAMICminolta_navalfuji_prop_Jv_RegisterClasseschildpropexif4byteepsilon_info_freeminolta_cpropevas_object_resizeepsilon_exif_info_direction_getepsilon_info_getexpprogs_finiputsfuji_ifdprognamemakerslightsrcsepeg_decode_size_setfreadecore_dlist_currentMD5Finalerrnoecore_event_handler_addecore_evas_buffer_newflashesfprintfmalloc_GLOBAL_OFFSET_TABLE_epeg_thumbnail_comments_getreallocepeg_closeecore_con_server_connectmkdirepsilon_ipc_server_sendepsilon_existsstrcasecmpgethostnameexifwarn2exif2sbyteecore_dlist_nextchromposecore_hash_getepeg_file_output_set.udivexifdieepsilon_addexif2byteecore_str_hashecore_hash_setepsilon_ipc_consumeperrorstrdupnewpropstrlenreadifdecore_event_handler_delforkfindspropecore_list_nextecore_event_addecore_con_initecore_dlist_appendjpegscanexeclpecore_shutdownimlib_image_formatecore_dlist_removeedje_object_file_setscenecaptypesepsilon_exif_info_getedje_object_addimgsensorsnikon_propfgetcsaturatereaddirpixelcompsepsilon_shutdown__ctypeecore_evas_getepsilon_delepsilon_initimlib_create_image_using_datafloor_etextprocessrangenikon_ifdusleepedje_initexifparseECORE_CON_EVENT_SERVER_ADDmemsetecore_list_destroyexif4sbytegainctrl.divmemmoveisnan__dso_handleECORE_CON_EVENT_SERVER_DELfinddescrgcd__iobstrrchrreadifds_PROCEDURE_LINKAGE_TABLE_casio_propEPSILON_EVENT_DONEexifwarnfindpropstrcmpecore_con_shutdownepsilon_thumb_initepeg_file_openepsilon_info_exif_props_printecore_hash_newepeg_size_getecore_init__register_frame_inforesunitsecore_event_type_newepsilon_freeecore_list_newecore_dlist_goto_firstepsilon_thumb_size_edataecore_evas_buffer_pixels_getstrerrorclosedirminolta_ifducommentMD5TransformECORE_CON_EVENT_SERVER_DATAstatopendirmemcmpstrncpyevas_object_moveexitecore_evas_freebyteReversecanon_propsnprintfolympus_ifdputcharsubjdistdlopenstrcatmetermodesas: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 @(#)SunOS 5.10 Generic January 2005as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun Compiler Common 10 Patch 05/06/2005 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 GCC: (GNU) 3.4.5as: Sun WorkShop 6 2003/12/18 Compiler Common 6.0 Patch 114802-02 ld: Software Generation Utilities - Solaris Link Editors: 5.10-1.482% : ;  : ;  : ; I8  I$ > : ; I : ; I8  : ; ( I !I/ $ >  : ;I' I' I& : ;  : ; I 8 < &I.? : ; ' I@ : ; I 4: ; I .? : ; ' @ 4: ; II4: ; I !I/!.: ; ' I@ ".? : ;' @ #: ;I $.? : ;' I@ %4: ;I&4: ;I '1(41) *.: ;' I +4: ;I,4: ;I -1.41 /: ;I0 U1 U24: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ >  : ; ( &I : ; .? : ; ' I@ : ; I 4: ; I4: ; I .? : ; ' @ 11 1 41 .: ; ' : ; I U.: ; ' I 4: ; I? < 4: ; I?  % $ > $ > : ; II!I/  : ;  : ; I8 .? : ; ' @ : ; I 4: ; I  I &I U.? : ; ' @ % $ > $ >  I : ;I: ; : ; I ' I  : ; : ; I8 : ; I8 <  : ; I 8 : ; I : ; .? : ; ' I@  : ; .? : ; ' I@ .: ; ' I@ : ; I : ; I .: ; ' @ 4: ; I 4: ; I4: ; I  .? : ;' I@ : ;I : ;I 4: ;I !4: ;I "1#41 $ U% U&41'.: ; I ( )I*!I/ +.? : ;' @ ,4: ; I? < -4: ; I?  % $ > $ >  I: ; I<  : ;  : ; I8 : ; I  : ; .? : ; ' I@ : ; I 4: ; I4: ; I  U .? : ; ' @ % $ >  I$ > : ; I : ; (  : ; : ; I8 : ; I8 &I .: ;' I@ : ;I : ;I 4: ;I 4: ;I I.: ;' @ .? : ;' @ 4: ;I U4: ; I? < I!I/ 4: ; I % $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I 11 4141  U4: ; I .: ; ' : ; I4: ; I.? : ;' I@ : ;I 4: ;I 4: ; I? < % $ >  I$ > : ; I : ; (  : ; : ; I8 &I I!I/ I.? : ;' @ : ;I 4: ;I .? : ;' I@ : ;I 4: ;I 4: ;I11 U41 11  U41.: ; ' : ; I!: ; I"4: ; I#4: ; I$.: ;' I %: ;I&: ;I'.: ;' (4: ;I)!*4: ; I? < % $ > : ; I$ >  I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I .? : ; ' I@ 4: ; I .? : ;' @ : ;I 4: ;I.? : ;' I@ 4: ;I 4: ; I? < 4: ; I?  !% $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I 4: ; I4: ; I  U.? : ; ' I@ 4: ; I? < % : ; I : ;  : ; I8  : ; I 8 $ >  I$ > &I .: ; ' I@ 4: ; I 4: ; I .? : ; ' I@ : ; I 1141  11 U.: ; ' I .: ; ' : ; I.? : ;' I@ : ;I I!I/ % $ > $ > : ; I I&I : ;  : ; I8 I !I/   I4: ; I?  % $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ;' @ : ;I 4: ;I 4: ;I U.? : ;' I@ 4: ; I? < 4: ; I % $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ;' @ : ;I 11 U4141 4: ;I .: ; ' : ; I4: ; I.? : ;' I@ 4: ; I? < 4: ; I % $ >  I$ > : ; I : ; (  : ; : ; I8 &I I !I/ .? : ; ' @ : ; I 4: ; I4: ; I  U.? : ; ' I@ 4: ; I? < % : ; I$ > $ >  I&I : ;  : ; I8 I !I/ 4: ; I?  4: ;I?  vGNU C 3.4.5Epsilon.c/home/falko/e/e17/libs/epsilon/src/libEpsilon_Exif_Info_Epsilon "hash##src$#thumb%#key&# w'#h'#tw(#th(#charintEpsilon*kw_Epsilon_Info -uri.#mtime/w#w0#h0#1#eei2#long long unsigned intVEpsilon_Info4 _Epsilon_Thumb_Size7 EPSILON_THUMB_NORMAL EPSILON_THUMB_LARGEEpsilon_Thumb_Size< &  long intunsigned charshort intlong long intshort unsigned intuint32_tJ long unsigned intulong_t_off_t&ino_tblkcnt_t&blksize_t&long double w mode_tkuid_ts&gid_twdev_tnlink_ttime_t&timespec&tv_sec'W#tv_nsec(&#timestruc_t>f  Imlib_Image 'Ecore_Free_Cb.Ecore_Hash_Cb1 ##)Ecore_Compare_Cb4BH]##Ecore_List7o_ecore_list7firstC>#lastD>#currentE>#free_funcG# nodesI#indexJ#Ecore_List_Node:8_ecore_list_node:data>#next?8#Ecore_Hash_Node[_ecore_hash_node next#key#value#DEcore_Hash^_ecore_hash buckets^#size#nodes#index# compare*#hash_func#free_key#free_value#]Epsilon_Plugin_Epsilon_Pluginmime_types d#epsilon_generate_thumb #Astatst_dev9#st_pad1A#st_ino#st_mode#st_nlinkG#st_uid#st_gid+# st_rdev9#$st_pad2#(st_size#0st_pad3&#4st_atim#8st_mtim#@st_ctim#Hst_blksize#Pst_blocks#Tst_fstypeQ#Xst_pad4a#h Q&  a  q& dirent d_ino#d_off#d_reclena#d_name#   ")dd_fd%#dd_loc&#dd_size'#dd_buf(# DIR)__FILE ; __FILE_cnt##_ptr$ #_base& #_flag'2# _file(2# __orientation)# __ionolock*# __seekable+# __filler,# 2FILEJ - JMD5ContextX buf #bits J#in Z# Zw  j2 ?MD5_CTX Epeg_Image* _Epeg_ImageEpeg_Thumbnail_Info+  _Epeg_Thumbnail_Info +uri/#mtime0w#w1#h1#2# Evas#E -_EvasEvas_Object#F H_Evas_Object 5Ecore_Evas$Ndouble epsilon_new(?vwnfile(> `(@h epsilon_free(Vwxne(U` Pepsilon_plugin_load(f PxxTnpath(eh(g Phdl_ref(hepsilon_plugin_init(i aj a P V epsilon_init(wxTz<ni(x`status(y~buf(z vdirs({ vde( 0`type(Xdir( 6b( P`plugin_path( n  0 q " xepsilon_key_set(z<zne(hkey( i epsilon_resolution_set(zz^e(Xw(Yh(Zepsilon_file_get( zz^e(Q(X{epsilon_thumb_file_get( z{ne(hi(astatus(~buf( vdirs({v  !epsilon_hash({|nfile( [n(Yctx( jmd5out(~hash()~hex(I@uri( v )  92  I  9"epsilon_info_free(|}n#info(`$"epsilon_info_get(&}~n#e(%h%fp('"&p((`&im(*(a&info(+ P%len(,'.~,~L(M)~,~L(M  y*Zepsilon_info_new(+($epsilon_info_exif_get(~~^#info(X$epsilon_mime_for_extension_get(~n#extension(h$epsilon_exists(Tn#e(h%ok(&i(a&filemtime(a%epsilonmtime(,$(~&dirs(~&home( v&buf( n&hash_seed(`' -) .$b.0`.;n  *I_epsilon_jpg_mtime_get(/file( +(%im((%info( $epsilon_generate(Tn#e(a%len(&iw(n&ih(n&tw(c&th(b&outfile( w&mime(Y,( PX&im( (`&info( w0%mtime(9&uri(: o&format(;o,$(<n%isedje(=%len(=&tmp(>`%src(?&ee(@b0 &dir(h18%evas(K&edje(L W`&pixels(MZ&w(Nh&h(Nc ] !"\epsilon_thumb_size(^#e(X#size(Y l - 2__iob\plugins_mime(%~yGNU C 3.4.5Epsilon_Exif.c/home/falko/e/e17/libs/epsilon/src/lib__FILEi(__FILE_cnt#(#_ptr$/#_base&/#_flag'5# _file(5# __orientation)F# __ionolock*F# __seekable+F# __filler,F# int5unsigned char/long long intFILEJ[long int/charint16_t <short intshort unsigned intlong long unsigned intlong unsigned int}long doubleu_int16_t8u_int32_t9F ;order LITTLE BIGexifprop,tag#type#count #value #name# descr#str#lvl#ifdseq(#ifdtag# override#"subtag#$next%#( };exiftagsprops%#tifforder#btiff/#etiff/# exifmaj#exifmin#mkrval#mkrinfo# Epsilon_Exif_Info\_Epsilon "hash##src$#thumb%#key&# w'(#h'(#tw((#th((#Epsilon*_Epsilon_Info -uri.#mtime/#w0(#h0(#mimetype1#eei2#Epsilon_Info4k wepsilon_info_exif_props_as_int_get(^eiwXlvlYpropjZnlist%Xpas( epsilon_info_exif_props_as_string_get5^ei3wXlvl3Yprop4jZn6list7%Xpas8(repsilon_info_exif_props_print]nei\whrhY_epsilon_exif_info_props_getflistd%lvldpase(ng xepsilon_exif_info_getnexbfp~amodeeeihtPldhhX `b\^$epsilon_read_exif_datafp~dumplvl(pas(mark(gotapp1(first(lenFrlenFexifbuf/t$+bepsilon_exif_info_free^eeiXepsilon_exif_info_direction_get^exXeeiYerrno((quiet (R7GNU C 3.4.5md5.c/home/falko/e/e17/libs/epsilon/src/lib<charshort intintlong long intunsigned charshort unsigned intuint32_tJRlong long unsigned int<long intlong unsigned intlong double\MD5ContextX buf #bits \#in l#l|?MD5_CTX  byteReverse ^ buf X longs RY t Q  MD5Init .L^ ctx -X | mMD5Transform Ln buf mh in si a f b e c d d c  y MD5Update =n ctx <c buf <b len <R` t >ah p LX  MD5Final mn digest lh ctx li count nR\ p o] GNU C 3.4.5epsilon_thumb.c/home/falko/e/e17/libs/epsilon/src/libYlong intunsigned charcharshort intintlong long intshort unsigned intYlong long unsigned intlong unsigned intlong doublepid_tcEcore_Event_Handler lEcore_Free_Cb.JP \ Ecore_List7n _ecore_list7 firstC<# lastD<# currentE<# free_funcG5# nodesI# indexJ#Ecore_List_Node: 6_ecore_list_node: l># next?6#\doublefloatoEcore_Con_Server*Cy_Ecore_Con_ServerEcore_Con_Event_Server_Data*U _Ecore_Con_Event_Server_Data *U server*v# l*w# size*x#aEpsilon_Request,"! _Epsilon_Request," id,&# size,'# status,(# path,)# dest,*# l,+#__FILE/ a__FILE/ _cnt0## _ptr0$[# _base0&[# _flag0'o# _file0(o# __orientation0)# __ionolock0*# __seekable0+# __filler0,# Epsilon_Message5x _Epsilon_Message5 head5# nid5# mid5# status5# thumbsize5# bufsize5# cl5#Epsilon_ClientI5"#dI 5" buffer5%# bufsize5&# offset5'# _Epsilon 6" hash6## src6$# f6%# key6&# w6'# h6'# tw6(# th6(#Epsilon6*depsilon_thumb_init7&hninit_error7d\con_init_error7bTqueue_error7`Lhandler_add_error7^8handler_del_error7\$handler_data_error7Zevent_type_error7Xepsilon_shutdown7mhn5epsilon_cb_server_add7}Dnl7|htype7|ievent7|jepsilon_cb_server_del7Dnl7htype7ievent7jepsilon_event_free7nl7hev7if7i yepsilon_cb_server_data7nl7htype7ievent7je7ymsg7`f7j|tb7`a repsilon_add7"npath7!dst7!isize7!l7!j f7#h!msg7$`" O r# `# a# }$# `# a# }% ^& $!tb73`' epsilon_client_connect7retries7buf7sockname7 (child7) *\+ epsilon_del7[nf7Zh!temp7\X,ECORE_CON_EVENT_SERVER_ADD*,ECORE_CON_EVENT_SERVER_DEL*,ECORE_CON_EVENT_SERVER_DATA*-EPSILON_EVENT_DONE7 ~p) *\,__iob1 debug7~ epsilon_init_count7~$epsilon_mid7~epsilon_request_queue7B~epsilon_server7~buffer7~(epsilon_server_add7 ~epsilon_server_del7 ~epsilon_server_data7 ~ >%HGNU C 3.4.5../../src/common/epsilon_thumb_common.c/home/falko/e/e17/libs/epsilon/src/liblong intunsigned charcharshort intintlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubledoublefloatEcore_Con_Server*CQ_Ecore_Con_ServerEcore_Con_Client*D}_Ecore_Con_Cliente9Epsilon_Message3=_Epsilon_Message3head3#nid3#mid3#status3# thumbsize3#bufsize3#cl3N#Epsilon_Client= q3"_ q 3"buffer3%#bufsize3&#offset3'# Pepsilon_message_new4 Pn nid4 b path4 i dst4 j status4 k size4 msg4 Phdstlen4 `pathlen4a body4 epsilon_ipc_client_send44^ cl43X msg43PY epsilon_ipc_server_send4; ^ srv4:X msg4:PY fepsilon_ipc_consume4EP n end4Dfcremains4Famsg4GPb(size4K`msg24LPhTepsilon_ipc_push4wHn end4vfh data4vi size4vjmid4Rw,,&,HGNU C 3.4.5canon.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintjunsigned charlong long intlong intcharint16_t <short intint32_t =]short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9{sorderLITTLEBIGPexifprop, tag3# type3# countD# valueD# nameP# P# str# lvl# ifdseq]# ifdtag3# override3#" subtag#$ next[#(V sexiftags props[# tifforderU# btiffd# etiffd# exifmaj# exifmin# mkrval# mkrinfo#+descrip> val?# @P#exiftagF tagG3# typeH3# countI3# lvlJ# nameKP# LP# tableM#ccstm 4 val5# 6P# table7# Lcanon_prop01t]PPn r[h r[ioffrjosUkvu3X canon_prop04]P^ [X [YoffZoU[ canon_propA0]8n [` [ioffjoUk canon_subval]8(n [htisubtagsjvalfunki]bj]Qv3`[aoffda+]fcanon_custom(n [hoffioUjtablefki]fj]dcnPacvev3Q[b)canon_propa,n `[ht`aib{`offsetc`vd3flmind3bflmaxd3kflunitd3itmpprope[`oncex]~4errno(]debug]Wcanon_macro=G^$canon_focustypeFp\<canon_qualityR^canon_flash\]canon_fbiaskY *canon_drive]Scanon_focus1C]d}canon_imageszm]D canon_shoot\canon_dzoom_canon_range\ #canon_iso \ Jcanon_meter :\l scanon_expmode c[  canon_whitebal Y + canon_tags ^< +canon_tags01 Y +canon_tags04V X I+canon_tagsA0j 9XX tccstm_offont dX@ ccstm_shutterz X ccstm_disen U ccstm_explvl X ccstm_autooff W Kccstm_shutspd ;W wccstm_aebseq gUh ccstm_shutsync T ccstm_lensaf W ccstm_endis T $ccstm_menubut W Pccstm_setbut @Wh {ccstm_yesno kVH ccstm_onoff WP ccstm_afsel U ccstm_afill U@ #ccstm_lcdpanels U Qccstm_usmmf AU {ccstm_explvlinc kU ccstm_tvavform U ccstm_shutterael V ccstm_afspot T0ccstm_afact TZccstm_regafJThccstm_lensaf1tT0ccstm_aisens&Tccstm_fscr/Vxccstm_finder5V`/canon_d30custom>V]canon_1dcustomTMR 5D,GNU C 3.4.5casio.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintjunsigned charlong long intlong intcharint16_t <short intint32_t =]short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9{sorderLITTLEBIGRexifprop, tag3# type3# countD# valueD# nameR# descrR# str# lvl# ifdseq]# ifdtag3# override3#" subtag#$ next]#(X sexiftags props]# tifforderU# btiffd# etiffd# exifmaj# exifmin# mkrval# mkrinfo#/descrip> val?# descr@R#exiftagF tagG3# typeH3# countI3# lvlJ# nameKR# descrLR# tableM#field \ tag]# type^# count_ # value` #  j  j eifd f tagg3# numh3# fieldsie# nextjk# !casio_prop4nprop]ht!i'h<HhQZYdyY once]~8cdcasio_prop1prop]t!i]v3casio_prop0prop]t!i]v3casio_ifdkDnoffset Dht !imyifdkldebug]  casio_record2a ; casio_qual>+a c casio_focusHSa  casio_flashS|a\  casio_intense^a<  casio_whitebha   casio_sharpu` 3 casio_range#` \ casio_sensitiveL` / casio_tags0y_ / casio_tags1_8  9iLDGNU C 3.4.5exif.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintiunsigned charlong long intsize_tRzlong intlong unsigned intdoublefloatcharlong doubleint16_t<short intint32_t=\short unsigned intlong long unsigned intu_int16_t80u_int32_t9zorder LITTLE BIG exifprop, tag`# type`# countq# valueq# name# descr# str# lvl0# ifdseq\# ifdtag`# override`#" subtag#$ next#(  -exiftags props# tifforder# btiffc# etiffc# exifmaj# exifmin# mkrval# mkrinfo# \descrip> val?!# descr@# exiftagF tagG`# typeH`# countI`# lvlJ0# nameK# descrL# tableM#- fieldtype S typeT`# nameU# sizeV# ifield \ tag]i# type^i# count_y# value`y# yi i ifd f tagg`# numh`# fieldsi# nextj# 0makerfun4 val5\# name6# propfun7# ifdfun8;# ;0yexiffreeDntyh`exifscany\nbchlen\i\jseq\kifdoffqtybcurifddtmpifdL'2=FR8QlZHk\|hp`i]`a'c1e=YGaRc]`kcvaPaXkreadtags dir seq\ ty!\"i\"tmporderreadtagL afieldJ ifdseqJ\ dirJ tJy!K\"iM\"jM\"propN#N$parsetag\%prop%dir%ty&\izlenzv`unqudqdenomqsn!sd!bufcd  exifparsey\Lnbchlen\ityacurpropi U ɴ   b Y  ( h     \ X postprop prop ty#"v`"valq"fval"o"h' (tweaklvli%proph%thycj(k 3i)*__ctypeX (*errno(\*debug\ m)*ftypes b \)*tags } -)*ucomment  -)*flashes  -)*filesrcs  )*makers:  IwLGNU C 3.4.5exifutil.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlong intsize_t?long long intunsigned charcharint16_t <short intint32_t =`short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9orderLITTLEBIGcexifprop, tagD# typeD# countU# valueU# namec# descrc# str/# lvl# ifdseq`# ifdtagD# overrideD#" subtag#$ nextn#(i exiftags propsn# tifforderf# btiff# etiff# exifmaj# exifmin# mkrval# mkrinfo#@descrip> val?# descr@c#fieldtype S typeTD# nameUc# sizeVs#field \ tag]# type^# count_# value`#    ;ifd f taggD# numhD# fieldsi;# nextjA# pexifdie>LT^msg=cX exifwarnGT\^msgFcX exifwarn2O\d^msg1NcXmsg2NcY exif2byte[DdԐ^bZXoZfYEexif2sbyteiԐ^bhXohfY}exif4bytewU ^bvXovfYexif4sbyte |^bXofY finddescr/Մ,ntable@[valDii`\c/hFfindpropn,t^propnXtagDYfindspropnt^propnXtagDYsubtagZnewpropndnpropnhchildpropndnparentnhpropnX Ahexprintnbhlen`ii``dumppropdnpropnhafield;ii`readifd(UdHnb'hdir'it'jifdsize)UQAtRreadifdsbAHڤnoffsetaUQtaifirstifdcAlcurifdcA`gcdyUڤnaxUhbxUierrno(`debug5`~hprogname6c~l Fftypes(`P GNU C 3.4.5fuji.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintiunsigned charlong long intlong intcharint16_t <short intint32_t =\short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9zrorderLITTLEBIGQexifprop, tag2# type2# countC# valueC# nameQ# descrQ# str# lvl# ifdseq\# ifdtag2# override2#" subtag#$ next\#(W rexiftags props\# tifforderT# btiffc# etiffc# exifmaj# exifmin# mkrval# mkrinfo#.descrip> val?# descr@Q#exiftagF tagG2# typeH2# countI2# lvlJ# nameKQ# descrLQ# tableM#field \ tag]# type^# count_ # value` #  i  i difd f tagg2# numh2# fieldsid# nextjj# fuji_propDnprop\htii\v2Yonce\~<bUfuji_ifdjDnoffsetChtimyifdjTfujitbXfujilen\fujioff\Qerrno(\debug\  fuji_sharp2sd  fuji_white>d`  fuji_colorMd@  fuji_flmodeWd $ fuji_boolbd K fuji_focusk;c s fuji_picturetcc  fuji_blurwc  fuji_focuswch  fuji_aewcP . fuji_tagsabSEGNU C 3.4.5jpeg.c/home/falko/e/e17/libs/epsilon/src/lib/exiftags__FILEj)__FILE_cnt#)#_ptr$0#_base&0#_flag'6# _file(6# __orientation)G# __ionolock*G# __seekable+G# __filler,G# int6unsigned charlong long intFILEJ\long intcharshort intshort unsigned intlong long unsigned intlong unsigned intlong double ~"jpgprocessBsofC)#strD# Kjpg1byte\)(n b]) jpg2bytenG(݌n b1oGa b2oGX mkrlenG݌n lGX ajpegscan)nfpahmarkgilenmjfirst)ksHd9dސkdސkޠߘ h`_)Gtopmkr)skipmkr lGsofmrkmark) i) lGAjpeginfo4)nprcsn2ghcmpnts2giheight2mjwidth2mkprcss3l infile3a~@ jpg_prcsn7)~D jpg_cmpnts8)~H jpg_height9G~L jpg_width:G~P jpg_prcss;~T seensof=)~Xw processEdyWGNU C 3.4.5makers.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlong intlong long intunsigned charcharshort intshort unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t 8!rfield \tag ]r#type ^r#count _#value `#    ifd ftag g #num h #fields i#next j#&9makerfun4val5^#name6#propfun7@#ifdfun8Q# @ 9 Q F g makers-Wu YGNU C 3.4.5minolta.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlunsigned charlong long intlong intlong unsigned intdoublefloatcharlong doubleint16_t<short intint32_t=_short unsigned intlong long unsigned intu_int16_t8u_int32_t9}orderLITTLEBIGgexifprop, tagH# typeH# countY# valueY# nameg# descrg# str# lvl# ifdseq_# ifdtagH# overrideH#" subtag#$ nextr#(m exiftags propsr# tifforderj# btifff# etifff# exifmaj# exifmin# mkrval# mkrinfo#Ddescrip> val? # descr@g#exiftagF tagGH# typeHH# countIH# lvlJ# nameKg# descrLg# tableM#field \ tag]# type^# count_!# value`!# !l  1l zifd f taggH# numhH# fieldsiz# nextj#1 cminolta_cpropnproprhoffitcjthetagsiki}bj}Qk}`vYmodel ed !cpf_valbuffcapropraxD minolta_naval(npropsrhtagHisubtagjproprjnag aminolta_prop(lnproprjtcii_fielddefsi[tmpproprX8once_~\minolta_ifd+lnoffset*Yht*caerrno(_debug_  minolta_brackmode8h  minolta_brackstepCjt / minolta_sharpMjT Z minolta_colorWJi|  minolta_isocui  minolta_booloj  minolta_focusmodexi<  minolta_focusareai$ 6 minolta_widefocus&iT e minolta_driveUj  minolta_whitebalkl  minolta_flashk  minolta_scenej  minolta_quality k A minolta_prog 1k k minolta_size [kD  minolta_folder i  minolta_imprint h  minolta_model i  minolta_metermode j JD minolta_tags :l uD ,minolta_0TLM1 eeH D minolta_unkn l ycGNU C 3.4.5nikon.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintjunsigned charlong long intlong intcharint16_t <short intint32_t =]short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9{sorderLITTLEBIGRexifprop, tag3# type3# countD# valueD# nameR# descrR# str# lvl# ifdseq]# ifdtag3# override3#" subtag#$ next]#(X sexiftags props]# tifforderU# btiffd# etiffd# exifmaj# exifmin# mkrval# mkrinfo#/descrip> val?# descr@R#exiftagF tagG3# typeH3# countI3# lvlJ# nameKR# descrLR# tableM#field \ tag]# type^# count_ # value` #  j  j eifd f tagg3# numh3# fieldsie# nextjk# 6nikon_proptnprop]ht6i< Q]Pfo`xXY$h`Xonce]~`cnikon_prop1prop]t6i]aDbDv3nikon_prop0prop]t6i]aDbD"nikon_ifd$ktnoffset#Dht#6imyifd%kldebug] A nikon_quality21n< l nikon_color?\n$  nikon_adjustHm  nikon_ccdTm  nikon_white_m  nikon_convertmmt :/ nikon_tags0v*nt c/ nikon_tags1SlgGNU C 3.4.5olympus.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagsintlunsigned char"long long intlong int"charint16_t <short intint32_t =_short unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t8u_int32_t9}uorderLITTLEBIGTexifprop, tag5# type5# countF# valueF# nameT# descrT# str # lvl# ifdseq_# ifdtag5# override5#" subtag#$ next_#(Z uexiftags props_# tifforderW# btifff# etifff# exifmaj# exifmin# mkrval# mkrinfo#1descrip> val?# descr@T#exiftagF tagG5# typeH5# countI5# lvlJ# nameKT# descrLT# tableM#field \ tag]# type^# count_# value`# l  l gifd f tagg5# numh5# fieldsig# nextjm# olympus_prop`Tnprop__ht_iia_abF`bbFXvc5Yoffsetd `aprope_boncez_~decolympus_ifdmTnoffsetFhtimyifdmlerrno(_debug_  olympus_macro4p  olympus_quality=p0 1 olympus_tagsGoxrlGNU C 3.4.5tagdefs.c/home/falko/e/e17/libs/epsilon/src/lib/exiftagssize_t-m//long intunsigned charcharshort intint32_t=intlong long intshort unsigned intlong long unsigned intlong unsigned intlong doubleu_int16_t 8?sdescrip >val ?#descr @9#exiftag Ftag G(#type H(#count I(#lvl J#name K9#descr L9# table M#D4fieldtype Stype T(#name U9#size V_# D t ftypes 44u is tb tags Yv, D t ucomment I}t D t flashes q D t filesrcs qh D t compresss Yt *D t pixelcomps bt SD t orients kCtp yD t planarconfigs zitX D t resunits t@ D t chromratios t( D t chrompos t D t expprogs  s DD t compconfig 4s mD t metermodes ]s8 D t lightsrcs r D t colorspcs q D t imgsensors qx D t scenetypes &qX ;D t customrend .+q@ eD t expmode 7Uq D t whitebal A|q D t scenecaptypes Jp D t gainctrl Up  D t processrange ap 5D t saturate k%pp ]D t subjdist uMpPu ../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includeexiftagsEpsilon.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hX11/X.hstddef.hX11/Xlib.hImlib2.hEcore_Data.hepsilon_plugin.hstat.hdirent.hdirent.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hmd5.hEpeg.hexif.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hEvas.hEcore_Evas.hEdje.hauxv.hdlfcn.hEpsilon.cv(Rvvvvv v vv vvv www4 w@w`whwlwpwtw"wwwwwwwwwwwxxx$x,x0x0x8x@xTxXx`xlx xxxyy4y8y<yHylyx yxy yyyyyyyz z zoz(-z<z@zLz\zhzxzzzzzzzzzzzzzzz{ {$ {({({0{X{|{{{{{){{{{{|| |<|D|L|P|X|\|`|d|t|x|"||||||||||}}} }$ }$}@}H}P}T}T}\Z}p}x}x}}}}}}}}}S~ ~ ~,~4~L?~PR~TB~X~\~`~d~h~l~l~t~~~`~~~~~~~~~ $(,08@DLPTT\dhptxxd3a$088@HHXX`x,<<|,|h,h,~ ~@8DTYd!h?L $44<HF\d~?U?U ((0dt0.f  008DT\dp|$A~!$Z,JT7\|J  c /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysexiftagsstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hEpsilon.hEpsilon_Exif.cerrno.h$)( LLT\hhpq$ .q$008 HlXd)lupp x!A `008@LLT2d[t#q#q/e#e#q(/(e0#8DLeP/PeX#`qu>\(6(^0858_@5`\`8hllt,H#d(<DD L\l? * /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/sys/usr/include/usr/include/sysiso/string_iso.hint_types.hmachtypes.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hmd5.hmd5.c 1 $(,048<@LPTX\lp4l @xH|Dt8l,`Dp(T4`@l Lx0\`dhlpx|~*n$048<<DT`ltt|,<HLPTXdp  ../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hEcore_Data.hsocket_impl.hun.hnet/if_dl.hnetinet/in.hmachlock.hmutex.hrwlock.hsemaphore.hcondvar.hrwstlock.hcred.huio.hresource.hvm/seg_enum.hkstat.hvmem.hkmem.havl_impl.havl.hvnode.hpoll.hmodel.hstrft.hstream.hnetconfig.hsocket.hnetdb.hEcore_Con.hEcore_File.hEpsilon_Request.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hepsilon_private.hEpsilon.hepsilon_thumb.c79OE488@ptt|$8LT\hlp| ,DHLX\`dhlp||  (0@XX`8`($`08@D#DqT#Tqd#dqt#tq|dF 04<X-m)O[`$((0<&X\lppx"r"m'Q,,48<@DTd-lx;Z) (44<Tdp|o Qe ../../src/common../../src/include/opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sys/usr/local/includemachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hsignal_iso.hsiginfo.hsignal.hprocset.hEcore.hsocket_impl.hun.hnet/if_dl.hnetinet/in.hmachlock.hmutex.hrwlock.hsemaphore.hcondvar.hrwstlock.hcred.huio.hresource.hvm/seg_enum.hkstat.hvmem.hkmem.havl_impl.havl.hvnode.hpoll.hmodel.hstrft.hstream.hnetconfig.hsocket.hnetdb.hEcore_Data.hEcore_Con.hstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hepsilon_private.hepsilon_thumb_common.c4  $((0<@@HTX`d hllt  " u(,04 8< <DLPT\dhlltt |   (48H  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hcanon.cerrno.hPTXdhhE N$+,,4W`<[ *n  b 0h'P9P``hp|   (8&<HTtt|,@DHLPTT\hk)j3p("8"Xs\\ $(( 0|$,0]H)X$q(u $$@DHLPTX\`hllt>Vo  8@DHLPTX\`dx& 2 $c$,oXX`pC>  Q(lx.xB% (0 LTF\l|@[ +,l /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hcasio.c48< HLhexm'm@C ((DPTX\`ddlx?U?   (8D  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.hmath_iso.hiso/math_c99.hmath.hieeefp.hfloatingpoint.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hexif.hexifint.hmakers.hexif.cctype_iso.herrno.hDHLLXhp!"r"  $$,4"4r<@D\\dpx||{u ,@H\`l|@PT`pxx hz (0{44<HlPPX`txd{  ,,4D`lpt$<4<`d4d`l4||||(~<DHx||(X,},4Lllt};$p~(<<DTXXX`ppx^ $04M 4t|œ8dX[ltt|Ðèðô~4Ĉ ĜĸŘ'X l|  ~ LT~`hL\lɀɀɈɌɐɐɴ{=W$44<Xʔʜʠʴ4r{@@H\`u`x[xˀFˀN˘mˠˠ˰˰˸˼FN,H\\| 8H[PPx̀@4 @LSXl΄ΐΨLθ|||u  HHXXhhπττϔϔϜϨ%o 2pЄЄФЬHм 44T`3xxрѸfM4@WTT\ҜaL 8DjLuӰ7ZL /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hexifutil.cerrno.hLQT\d dhhpԀԐԐԔԔԜԬԴ  $$,TՄՈՌ՜դ,,8ttր  (,4 d(hp x׀ׄ׈׌אהטלtנפר׬װ״* ,HPPltt|#|r؄جؼDd$hp |ــو'ِr٘٠٤٤٬ٴ(k)s!l$u8H<L`dhlltڌڤڨڬڬڴ7 /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hfuji.cerrno.h4@DHLPTT\pp xیی۔۠۰۸o%r 4D H PTl`(h |܄ ܐܔܠܨܨܼܰ? /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hjpeg.co(#,0<PXtt|݌ݜݤݬݰݰݸ~@  uHu\xdlxހސސޠIޠި޼ $$,<<DLPT\`hlt||߄ߘGߠߴU߼߼_H8 /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/sys/usr/include/usr/include/sysiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hmakers.c  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/iso/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hstdio_iso.hstdio.hstdlib_iso.hstdlib_c99.hstdlib.hmath_iso.hiso/math_c99.hmath.hieeefp.hfloatingpoint.hmachtypes.hint_types.hsys/types.htime_impl.htime.htime_iso.htime.hselect.hexif.hexifint.hmakers.hminolta.cerrno.h $u048Dllxx   (4@@LXXX `lt~t| 0 $\~dthlptt|%~ 8I<@DHHPe1i +]7$C,Q4lpcX\`p-E",:04LPdppx砺* h$\<(Tul[%rgg(,0 <@ @hpp4` ?8HH PXX `l|    $$,<<DLLTl|EU0(^,?,U4L\dhl[a(8@\lspx   /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.hnikon.c  U088T`dhlptt|8\^$R@lpp&nkR>$0H`dhhp <stqx  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/usr/include/usr/include/sysstdarg.hva_list.hstdio_tag.hstdio_impl.hiso/stdio_iso.hstdio.hiso/stdlib_iso.hiso/stdlib_c99.hstdlib.hmachtypes.hint_types.hsys/types.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.hmakers.holympus.cerrno.hs t  (00LX\`dhllt ?$I % $(,048DPTX\`dhlpt|(t,4 T)X` l  /opt/csw/gcc3/lib/gcc/sparc-sun-solaris2.8/3.4.5/include/sys/usr/include/usr/include/sysiso/string_iso.hmachtypes.hint_types.htypes.htime_impl.htime.hiso/time_iso.htime.hselect.hexif.hexifint.htagdefs.c | v - w - xL - xT - z<T -  z8 zz - { - | - } -  ~(~ -  - Tl -  4 |    -  -  $  |  (@ (<(L L - ( - ( -  |  - h - @ - DP - L -  -  - l -  |  -     -  -  |  P -   PT  -  8 -  ( -  \ -  | 4 -  -  | Dd -  - \  -  |  xL xT x\ xd, xԐ4 x\ x \xՄ -  x,H xttx| - xd\ - xH - x\ - xd - xH\ - xڤ0 -  | h - D -  | @, - @(d - @݌@ - @ - @x -  | h -  - (D - lx -  | \ - \tl -  | l - T` - ^ uepsilon_new epsilon_free epsilon_plugin_load gepsilon_init